Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3609.t1
Gene name
Locationscaffold_06:215474..220799
Strand-
Gene length (bp)5325
Transcript length (bp)5163
Coding sequence length (bp)5163
Protein length (aa) 1721

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12783 Sec7_N Guanine nucleotide exchange factor in Golgi transport N-terminal 1.6E-40 200 354
PF16213 DCB Dimerisation and cyclophilin-binding domain of Mon2 4.4E-41 4 175
PF16206 Mon2_C C-terminal region of Mon2 protein 2.0E-21 1000 1226

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3609.t1
MSSQFLQTELANLIHESRRKNSDLRNAAEQSLNELKALPSTSEAQIAADLVRKPNFVEPFIIACYTRHAKLAGIG
VICLQRLIASRSLPSSRLKDVLGGLKETTSLSLDIQLKILQSLPSLLQFYSNELSGELLANTLEICATLQASKTI
AVSSTAAATLQQLVVSTFERVSSEDSLPKDVKITTTIKVDGQSLDIGYFAYDALQVLDDLCRLIDGEPLQFLRTR
TLPPTFVLELIESILLNSGRLFVGHPELSQVLRVRLLPLAVRCLSERYSFAQTVRVARILLILLKRHMSLLPTEC
EMALSLITHLVEPDGTAPWKRLLCMEIFRGLYSEPGTVRLIYTLYDSEEGRKNILRDHMAALVRLASEKPSLIGV
SNQSTVPSRAEHSRSTTEDQITLETGGVAGVIGSTVPPSETKVPGISTQWSVVRTPYIDLLDKTEPPTPPDTYIY
SLVLNCISSFAEGLAKFILPLTVPDLKQRRKNRLMSPVQGPDSARSSQDFPAEPMRAQSSSSSKKSHVPINPLDL
QSHVQYSAIKTCAGIIENCWPAVLAACSTFLRASLDDEYYHNLVRAFQKLAHVAGLLRLSVPRDAFLTTLGKAAT
PVSGAKSHNVSATGSQQSDTPQKKRRSADLSSLASSLSLEPTAVEGPPVSLSTRNLLCMRALLNLGIALGPTLDQ
PAWSIIFETLQYTGLVIGMSSSAMVKSASGTGETPVTPGNDVPTANLGTEVIAVQAASNKMLESTSDFPSASFEE
ILLALLNLSAFTEQCRNMNDAPGVSDIPRTPQSPQAGGRLHQGSRRVSHTVGKSRMQDEELKFVLEKANELAKAN
LGRLSSLEKDDSKAWELLTQSLISTSANTTVSPNLRLQASAILNSIVFSTMKQRDEDDEKVYNQVQTRNLQTLKA
QVASLYASDMHTSKSLPITVIEIHEQTLEVLNNILEQYAETFVDGWNLIFDLISGVFQHAPDPGPGDRPSTLIER
RSSALPAGPRLVRAAYKSLHLVASDFLSLLPAPCLLSLVNAFSSFTSQTQDFNISLTTTSFFWNVSDFLQAQIEQ
ISVDHVDASVSEEEIAKLAHNQDPSVSRNSLWLLLLLRIVDITTDSRPEVRNSAVHTLLRIFDAYGQQLSPEAWR
LCLNMVLFKMAEGIETPLLQAKNNRSSTKPDDFKAWVDTTVVMIKGLSTLIKNFFETLVHDEKFDQSWKRLLKYL
QSLIDLHILDFSEATFSSLSTILLRVQNGCELSNDALECAWLLWANGHPASDEKALDLDQPNQDAALAYLHTFQQ
IYRLYKDQLSTGHIENVLHHLSLLVWNSVSPRYSPDIDRPSALQALVIDCVKTLCLEKEDSQPNILLCLAELSDS
ALSKWSPGSDTRRPGFVAFSKRTIDLVSWYIAEFGIKQNVFMNGALAKSLEHLSTLIAEKYTWQGKDREPFLWQK
ATTVSLNVLQVAVPYVEKQYTKANESETSQFWQHIVSITNGIVSARGFQTQQLPNARILTDEAFDIKAFTRLKTL
ILPSLGAAAIPDAVRRDFARALFNSSFIYAPLRFDLPTGLEDAPLQDFYTVRPGRTFDPPPTLRPGIAYVLLDTL
FELAAHSQAETETKADAPSPQTLLARSISPYLLLRCAVSLKSYIADQPLRGLMPQPTPARKALLHLLVRMVELKS
EPSAIPDPPSLKTISGISGEDPEEHHYRKHLEWIYPLVVRAVQVAGKERDDGQILQALGKVLQEIGRFEY*
Coding >Pro_DTO377G3_2|g3609.t1
ATGTCCTCCCAATTCTTGCAGACGGAGCTCGCCAATTTGATACATGAGTCTCGAAGGAAAAACTCCGATTTGCGA
AATGCCGCTGAACAATCATTGAATGAGCTCAAAGCACTGCCCTCAACTTCAGAGGCTCAGATAGCAGCAGATCTT
GTTCGCAAACCGAATTTCGTCGAGCCATTCATCATTGCATGCTATACTCGGCATGCGAAGCTTGCCGGTATTGGT
GTGATCTGTTTACAGAGACTAATTGCATCTCGGTCATTACCCTCGAGCCGTTTGAAGGATGTTCTCGGGGGCCTG
AAGGAGACAACGAGCTTGAGTCTTGATATCCAACTGAAGATTCTACAATCTCTGCCTTCGCTTTTGCAATTTTAT
TCCAATGAATTGAGCGGGGAGCTTCTTGCGAATACGTTGGAAATATGCGCCACATTACAGGCAAGCAAAACGATT
GCAGTCTCTAGTACTGCCGCGGCTACTCTCCAACAGCTGGTGGTATCGACCTTTGAAAGAGTTTCGAGCGAAGAC
AGCCTTCCGAAGGATGTCAAAATCACCACAACCATCAAAGTCGATGGTCAGTCGCTCGACATCGGCTACTTCGCC
TATGATGCACTGCAAGTATTGGATGATCTCTGTCGTCTGATTGATGGTGAGCCACTACAGTTTCTGCGAACACGA
ACCCTACCCCCGACCTTTGTACTCGAACTTATCGAGAGTATTCTCTTGAACAGCGGCCGTCTTTTTGTGGGACAT
CCCGAACTTTCGCAAGTGCTGCGCGTTCGGTTGTTACCACTAGCCGTCCGTTGTCTATCTGAGAGGTATTCATTC
GCTCAAACCGTCCGAGTCGCTCGAATTCTTCTCATTCTTCTGAAGCGTCATATGTCTCTCTTGCCCACAGAATGT
GAGATGGCATTGAGTCTGATAACCCATCTCGTTGAACCGGATGGGACAGCGCCTTGGAAGAGACTACTCTGCATG
GAAATCTTCCGAGGGCTATACTCGGAGCCGGGTACTGTGCGGCTGATCTACACTTTGTATGACAGTGAGGAAGGC
AGAAAGAACATCCTTCGTGACCACATGGCGGCACTTGTTCGGCTAGCTTCGGAGAAGCCTTCGTTGATTGGTGTC
AGTAATCAATCAACGGTACCTTCACGTGCAGAGCACTCAAGATCAACCACAGAGGATCAGATAACTCTTGAAACT
GGCGGTGTTGCTGGTGTCATTGGATCAACTGTTCCTCCAAGTGAAACCAAGGTGCCTGGAATTAGCACTCAGTGG
AGTGTTGTTCGTACGCCATATATCGATCTCCTCGACAAGACGGAACCGCCCACACCGCCGGACACCTACATTTAC
AGCCTGGTCCTTAATTGTATCAGCAGCTTTGCTGAAGGGCTCGCGAAATTCATTCTTCCATTAACGGTCCCGGAT
CTCAAGCAAAGACGCAAGAATCGACTTATGAGCCCCGTTCAGGGACCCGACTCCGCTAGATCTTCTCAAGATTTT
CCAGCAGAACCCATGCGAGCGCAGTCTAGCTCATCATCGAAAAAATCACATGTTCCCATCAATCCTCTGGACCTG
CAGTCTCATGTACAGTACTCCGCCATCAAGACTTGCGCGGGGATAATAGAGAACTGTTGGCCCGCTGTCCTAGCA
GCTTGTTCCACCTTTTTGCGCGCATCTTTAGATGACGAGTATTACCATAATCTTGTTCGAGCATTCCAAAAGCTA
GCTCATGTGGCGGGTCTTCTGAGATTATCCGTTCCCCGAGATGCTTTCTTAACAACTCTTGGAAAGGCTGCTACG
CCTGTGAGTGGTGCCAAGTCACACAATGTGTCTGCCACCGGCTCCCAGCAAAGTGACACACCCCAAAAGAAACGG
AGAAGTGCGGATCTGTCAAGTCTGGCCAGTTCTTTATCACTGGAGCCTACTGCGGTGGAAGGTCCTCCTGTGTCT
TTAAGTACGAGAAACCTACTTTGTATGCGGGCTTTGCTTAACCTCGGAATTGCTTTGGGGCCGACATTGGATCAG
CCGGCCTGGTCTATTATTTTTGAAACACTTCAATATACTGGACTGGTGATTGGCATGTCCTCAAGTGCAATGGTC
AAATCGGCTAGCGGTACTGGGGAGACTCCAGTCACCCCAGGAAACGATGTTCCAACTGCCAATCTTGGGACTGAG
GTGATTGCGGTTCAGGCGGCTTCTAACAAAATGCTCGAAAGCACCAGCGATTTCCCAAGTGCATCTTTTGAAGAA
ATATTACTTGCCTTGTTGAATCTGTCAGCATTCACCGAACAGTGTCGCAACATGAATGATGCCCCAGGAGTATCA
GACATACCTCGAACACCGCAATCACCCCAGGCAGGTGGACGCTTGCACCAAGGTTCCCGGCGCGTATCGCATACT
GTCGGAAAATCAAGAATGCAAGACGAGGAACTCAAATTTGTATTGGAGAAAGCAAATGAACTAGCCAAGGCAAAT
CTTGGGAGACTGTCTTCGCTCGAGAAAGATGACAGCAAAGCATGGGAGCTACTGACGCAAAGTCTCATCTCTACT
TCCGCAAATACTACCGTCAGTCCGAATCTTCGCCTGCAGGCAAGCGCGATTTTGAACTCGATCGTATTCTCAACA
ATGAAACAAAGGGACGAAGACGATGAGAAAGTCTACAATCAAGTGCAGACGAGGAATCTGCAGACATTGAAAGCC
CAGGTCGCCTCGCTCTATGCATCGGACATGCACACGTCCAAGTCTTTGCCAATAACCGTCATTGAAATCCACGAA
CAGACCTTGGAAGTGTTAAATAATATTCTGGAACAGTATGCAGAAACTTTCGTGGACGGATGGAACCTCATCTTT
GATTTAATATCTGGTGTTTTTCAACATGCCCCAGATCCTGGACCTGGCGATCGGCCTTCTACTCTGATAGAGCGC
AGATCATCGGCTCTTCCAGCAGGCCCCCGGTTGGTACGTGCTGCCTATAAGTCTTTGCATCTTGTCGCATCCGAC
TTCCTTTCTCTGCTACCAGCGCCCTGTCTCTTAAGCTTGGTGAATGCCTTCTCTAGCTTTACGTCGCAAACCCAA
GATTTCAATATCTCCCTCACCACCACCTCGTTTTTCTGGAACGTTTCGGACTTTCTCCAGGCCCAAATTGAGCAA
ATCTCAGTTGACCATGTTGATGCGTCTGTCAGCGAAGAAGAAATAGCTAAACTAGCACATAACCAAGACCCTTCT
GTTTCCCGGAACTCGCTGTGGCTGCTGCTGCTGCTTCGCATCGTTGATATCACGACAGATAGTCGACCTGAGGTT
CGAAACAGTGCAGTCCATACGCTTCTACGCATCTTCGACGCCTATGGGCAGCAGCTCTCCCCCGAGGCGTGGCGT
CTGTGCCTAAACATGGTTCTCTTCAAGATGGCTGAGGGAATTGAGACCCCTCTCCTCCAAGCGAAGAACAACCGA
AGCAGTACAAAACCTGATGACTTCAAGGCGTGGGTGGATACAACAGTGGTGATGATCAAGGGTTTATCAACTCTG
ATCAAGAATTTCTTCGAGACCCTTGTGCACGACGAGAAGTTCGATCAATCCTGGAAGCGACTTTTGAAGTACCTG
CAAAGTCTGATTGACTTGCATATTTTGGATTTCAGCGAAGCAACATTTTCTAGCCTCTCTACGATCCTCCTCCGG
GTGCAGAATGGATGTGAACTTAGCAACGATGCTCTTGAGTGTGCGTGGCTTCTATGGGCAAATGGCCACCCTGCT
AGCGACGAGAAGGCGCTTGACTTAGATCAACCTAACCAGGACGCGGCTTTGGCTTATCTACATACATTCCAACAG
ATCTATCGTCTTTACAAAGATCAGTTGAGTACGGGACACATTGAAAACGTCCTTCATCATCTCAGTTTGCTGGTG
TGGAACTCGGTCTCCCCGCGCTACTCTCCAGATATCGATCGACCCTCGGCCTTGCAAGCGCTAGTCATTGATTGT
GTCAAAACGCTCTGCCTGGAGAAAGAGGACTCCCAGCCGAATATTCTCTTGTGTCTTGCCGAATTATCCGATTCA
GCATTATCCAAATGGAGCCCCGGCAGCGACACTCGAAGACCAGGATTCGTGGCCTTCTCGAAACGCACTATCGAT
CTTGTCAGCTGGTACATTGCCGAATTCGGCATCAAGCAAAACGTCTTCATGAATGGTGCTCTTGCAAAATCACTC
GAACACCTCAGTACTCTAATTGCGGAAAAGTACACATGGCAAGGGAAGGATCGCGAGCCGTTCCTATGGCAAAAG
GCCACAACAGTATCTCTGAACGTTCTGCAAGTCGCTGTCCCCTACGTGGAAAAGCAATACACGAAGGCAAACGAG
TCCGAAACATCTCAGTTCTGGCAACATATTGTTAGCATTACAAACGGAATTGTTTCCGCCCGTGGCTTCCAAACC
CAACAACTCCCCAACGCCCGAATCCTCACAGACGAAGCATTCGACATCAAAGCCTTCACCCGCCTGAAGACCCTC
ATCCTCCCATCCCTCGGCGCAGCAGCAATCCCGGACGCCGTCCGCCGCGATTTCGCCCGCGCTCTCTTCAACTCC
TCCTTCATCTACGCTCCCCTCCGCTTCGACCTACCCACCGGCCTCGAAGACGCACCCCTACAGGACTTCTATACC
GTCCGCCCCGGCCGCACCTTCGACCCACCGCCGACCCTGCGCCCGGGAATAGCCTATGTCCTTCTAGACACGCTC
TTCGAGCTCGCCGCACACTCGCAAGCCGAGACCGAGACAAAAGCCGACGCTCCATCCCCGCAGACTCTGCTCGCC
CGCTCGATCTCGCCCTATCTCCTTCTGCGCTGCGCGGTCTCGCTCAAGTCTTACATTGCAGACCAGCCTTTGCGT
GGCTTGATGCCCCAACCCACGCCTGCCCGCAAGGCCCTGCTCCATCTGCTCGTCCGCATGGTCGAGCTGAAGAGT
GAGCCGTCGGCTATCCCGGATCCGCCTTCGCTGAAGACCATCTCGGGTATCTCGGGTGAGGATCCGGAGGAGCAT
CACTATCGGAAGCATCTCGAGTGGATTTATCCGTTGGTTGTGCGCGCTGTGCAGGTTGCTGGCAAGGAGCGCGAT
GATGGGCAGATTCTCCAGGCGCTGGGGAAGGTGTTGCAGGAAATTGGTCGGTTTGAGTATTAG
Transcript >Pro_DTO377G3_2|g3609.t1
ATGTCCTCCCAATTCTTGCAGACGGAGCTCGCCAATTTGATACATGAGTCTCGAAGGAAAAACTCCGATTTGCGA
AATGCCGCTGAACAATCATTGAATGAGCTCAAAGCACTGCCCTCAACTTCAGAGGCTCAGATAGCAGCAGATCTT
GTTCGCAAACCGAATTTCGTCGAGCCATTCATCATTGCATGCTATACTCGGCATGCGAAGCTTGCCGGTATTGGT
GTGATCTGTTTACAGAGACTAATTGCATCTCGGTCATTACCCTCGAGCCGTTTGAAGGATGTTCTCGGGGGCCTG
AAGGAGACAACGAGCTTGAGTCTTGATATCCAACTGAAGATTCTACAATCTCTGCCTTCGCTTTTGCAATTTTAT
TCCAATGAATTGAGCGGGGAGCTTCTTGCGAATACGTTGGAAATATGCGCCACATTACAGGCAAGCAAAACGATT
GCAGTCTCTAGTACTGCCGCGGCTACTCTCCAACAGCTGGTGGTATCGACCTTTGAAAGAGTTTCGAGCGAAGAC
AGCCTTCCGAAGGATGTCAAAATCACCACAACCATCAAAGTCGATGGTCAGTCGCTCGACATCGGCTACTTCGCC
TATGATGCACTGCAAGTATTGGATGATCTCTGTCGTCTGATTGATGGTGAGCCACTACAGTTTCTGCGAACACGA
ACCCTACCCCCGACCTTTGTACTCGAACTTATCGAGAGTATTCTCTTGAACAGCGGCCGTCTTTTTGTGGGACAT
CCCGAACTTTCGCAAGTGCTGCGCGTTCGGTTGTTACCACTAGCCGTCCGTTGTCTATCTGAGAGGTATTCATTC
GCTCAAACCGTCCGAGTCGCTCGAATTCTTCTCATTCTTCTGAAGCGTCATATGTCTCTCTTGCCCACAGAATGT
GAGATGGCATTGAGTCTGATAACCCATCTCGTTGAACCGGATGGGACAGCGCCTTGGAAGAGACTACTCTGCATG
GAAATCTTCCGAGGGCTATACTCGGAGCCGGGTACTGTGCGGCTGATCTACACTTTGTATGACAGTGAGGAAGGC
AGAAAGAACATCCTTCGTGACCACATGGCGGCACTTGTTCGGCTAGCTTCGGAGAAGCCTTCGTTGATTGGTGTC
AGTAATCAATCAACGGTACCTTCACGTGCAGAGCACTCAAGATCAACCACAGAGGATCAGATAACTCTTGAAACT
GGCGGTGTTGCTGGTGTCATTGGATCAACTGTTCCTCCAAGTGAAACCAAGGTGCCTGGAATTAGCACTCAGTGG
AGTGTTGTTCGTACGCCATATATCGATCTCCTCGACAAGACGGAACCGCCCACACCGCCGGACACCTACATTTAC
AGCCTGGTCCTTAATTGTATCAGCAGCTTTGCTGAAGGGCTCGCGAAATTCATTCTTCCATTAACGGTCCCGGAT
CTCAAGCAAAGACGCAAGAATCGACTTATGAGCCCCGTTCAGGGACCCGACTCCGCTAGATCTTCTCAAGATTTT
CCAGCAGAACCCATGCGAGCGCAGTCTAGCTCATCATCGAAAAAATCACATGTTCCCATCAATCCTCTGGACCTG
CAGTCTCATGTACAGTACTCCGCCATCAAGACTTGCGCGGGGATAATAGAGAACTGTTGGCCCGCTGTCCTAGCA
GCTTGTTCCACCTTTTTGCGCGCATCTTTAGATGACGAGTATTACCATAATCTTGTTCGAGCATTCCAAAAGCTA
GCTCATGTGGCGGGTCTTCTGAGATTATCCGTTCCCCGAGATGCTTTCTTAACAACTCTTGGAAAGGCTGCTACG
CCTGTGAGTGGTGCCAAGTCACACAATGTGTCTGCCACCGGCTCCCAGCAAAGTGACACACCCCAAAAGAAACGG
AGAAGTGCGGATCTGTCAAGTCTGGCCAGTTCTTTATCACTGGAGCCTACTGCGGTGGAAGGTCCTCCTGTGTCT
TTAAGTACGAGAAACCTACTTTGTATGCGGGCTTTGCTTAACCTCGGAATTGCTTTGGGGCCGACATTGGATCAG
CCGGCCTGGTCTATTATTTTTGAAACACTTCAATATACTGGACTGGTGATTGGCATGTCCTCAAGTGCAATGGTC
AAATCGGCTAGCGGTACTGGGGAGACTCCAGTCACCCCAGGAAACGATGTTCCAACTGCCAATCTTGGGACTGAG
GTGATTGCGGTTCAGGCGGCTTCTAACAAAATGCTCGAAAGCACCAGCGATTTCCCAAGTGCATCTTTTGAAGAA
ATATTACTTGCCTTGTTGAATCTGTCAGCATTCACCGAACAGTGTCGCAACATGAATGATGCCCCAGGAGTATCA
GACATACCTCGAACACCGCAATCACCCCAGGCAGGTGGACGCTTGCACCAAGGTTCCCGGCGCGTATCGCATACT
GTCGGAAAATCAAGAATGCAAGACGAGGAACTCAAATTTGTATTGGAGAAAGCAAATGAACTAGCCAAGGCAAAT
CTTGGGAGACTGTCTTCGCTCGAGAAAGATGACAGCAAAGCATGGGAGCTACTGACGCAAAGTCTCATCTCTACT
TCCGCAAATACTACCGTCAGTCCGAATCTTCGCCTGCAGGCAAGCGCGATTTTGAACTCGATCGTATTCTCAACA
ATGAAACAAAGGGACGAAGACGATGAGAAAGTCTACAATCAAGTGCAGACGAGGAATCTGCAGACATTGAAAGCC
CAGGTCGCCTCGCTCTATGCATCGGACATGCACACGTCCAAGTCTTTGCCAATAACCGTCATTGAAATCCACGAA
CAGACCTTGGAAGTGTTAAATAATATTCTGGAACAGTATGCAGAAACTTTCGTGGACGGATGGAACCTCATCTTT
GATTTAATATCTGGTGTTTTTCAACATGCCCCAGATCCTGGACCTGGCGATCGGCCTTCTACTCTGATAGAGCGC
AGATCATCGGCTCTTCCAGCAGGCCCCCGGTTGGTACGTGCTGCCTATAAGTCTTTGCATCTTGTCGCATCCGAC
TTCCTTTCTCTGCTACCAGCGCCCTGTCTCTTAAGCTTGGTGAATGCCTTCTCTAGCTTTACGTCGCAAACCCAA
GATTTCAATATCTCCCTCACCACCACCTCGTTTTTCTGGAACGTTTCGGACTTTCTCCAGGCCCAAATTGAGCAA
ATCTCAGTTGACCATGTTGATGCGTCTGTCAGCGAAGAAGAAATAGCTAAACTAGCACATAACCAAGACCCTTCT
GTTTCCCGGAACTCGCTGTGGCTGCTGCTGCTGCTTCGCATCGTTGATATCACGACAGATAGTCGACCTGAGGTT
CGAAACAGTGCAGTCCATACGCTTCTACGCATCTTCGACGCCTATGGGCAGCAGCTCTCCCCCGAGGCGTGGCGT
CTGTGCCTAAACATGGTTCTCTTCAAGATGGCTGAGGGAATTGAGACCCCTCTCCTCCAAGCGAAGAACAACCGA
AGCAGTACAAAACCTGATGACTTCAAGGCGTGGGTGGATACAACAGTGGTGATGATCAAGGGTTTATCAACTCTG
ATCAAGAATTTCTTCGAGACCCTTGTGCACGACGAGAAGTTCGATCAATCCTGGAAGCGACTTTTGAAGTACCTG
CAAAGTCTGATTGACTTGCATATTTTGGATTTCAGCGAAGCAACATTTTCTAGCCTCTCTACGATCCTCCTCCGG
GTGCAGAATGGATGTGAACTTAGCAACGATGCTCTTGAGTGTGCGTGGCTTCTATGGGCAAATGGCCACCCTGCT
AGCGACGAGAAGGCGCTTGACTTAGATCAACCTAACCAGGACGCGGCTTTGGCTTATCTACATACATTCCAACAG
ATCTATCGTCTTTACAAAGATCAGTTGAGTACGGGACACATTGAAAACGTCCTTCATCATCTCAGTTTGCTGGTG
TGGAACTCGGTCTCCCCGCGCTACTCTCCAGATATCGATCGACCCTCGGCCTTGCAAGCGCTAGTCATTGATTGT
GTCAAAACGCTCTGCCTGGAGAAAGAGGACTCCCAGCCGAATATTCTCTTGTGTCTTGCCGAATTATCCGATTCA
GCATTATCCAAATGGAGCCCCGGCAGCGACACTCGAAGACCAGGATTCGTGGCCTTCTCGAAACGCACTATCGAT
CTTGTCAGCTGGTACATTGCCGAATTCGGCATCAAGCAAAACGTCTTCATGAATGGTGCTCTTGCAAAATCACTC
GAACACCTCAGTACTCTAATTGCGGAAAAGTACACATGGCAAGGGAAGGATCGCGAGCCGTTCCTATGGCAAAAG
GCCACAACAGTATCTCTGAACGTTCTGCAAGTCGCTGTCCCCTACGTGGAAAAGCAATACACGAAGGCAAACGAG
TCCGAAACATCTCAGTTCTGGCAACATATTGTTAGCATTACAAACGGAATTGTTTCCGCCCGTGGCTTCCAAACC
CAACAACTCCCCAACGCCCGAATCCTCACAGACGAAGCATTCGACATCAAAGCCTTCACCCGCCTGAAGACCCTC
ATCCTCCCATCCCTCGGCGCAGCAGCAATCCCGGACGCCGTCCGCCGCGATTTCGCCCGCGCTCTCTTCAACTCC
TCCTTCATCTACGCTCCCCTCCGCTTCGACCTACCCACCGGCCTCGAAGACGCACCCCTACAGGACTTCTATACC
GTCCGCCCCGGCCGCACCTTCGACCCACCGCCGACCCTGCGCCCGGGAATAGCCTATGTCCTTCTAGACACGCTC
TTCGAGCTCGCCGCACACTCGCAAGCCGAGACCGAGACAAAAGCCGACGCTCCATCCCCGCAGACTCTGCTCGCC
CGCTCGATCTCGCCCTATCTCCTTCTGCGCTGCGCGGTCTCGCTCAAGTCTTACATTGCAGACCAGCCTTTGCGT
GGCTTGATGCCCCAACCCACGCCTGCCCGCAAGGCCCTGCTCCATCTGCTCGTCCGCATGGTCGAGCTGAAGAGT
GAGCCGTCGGCTATCCCGGATCCGCCTTCGCTGAAGACCATCTCGGGTATCTCGGGTGAGGATCCGGAGGAGCAT
CACTATCGGAAGCATCTCGAGTGGATTTATCCGTTGGTTGTGCGCGCTGTGCAGGTTGCTGGCAAGGAGCGCGAT
GATGGGCAGATTCTCCAGGCGCTGGGGAAGGTGTTGCAGGAAATTGGTCGGTTTGAGTATTAG
Gene >Pro_DTO377G3_2|g3609.t1
ATGTCCTCCCAATTCTTGCAGACGGAGCTCGCCAATTTGATACATGAGTCTCGAAGGAAAAACTCCGATTTGCGA
AATGTTGGTTATCACTCTCTAGGCATCATCGGCCATGGCACACTAACGAGGAACTAACAGGCCGCTGAACAATCA
TTGAATGAGCTCAAAGCACTGCCCTCAACTTCAGAGGCTCAGATAGCAGCAGGTAATTTTCTATATGGCAACCAT
TTGTCAATTTTCAACCGCTAAAACGGCATTAGATCTTGTTCGCAAACCGAATTTCGTCGAGCCATTCATCATTGC
ATGCTATACTCGGCATGCGAAGCTTGCCGGTATTGGTGTGATCTGTTTACAGAGACTAATTGCATCTCGGTCATT
ACCCTCGAGCCGTTTGAAGGATGTTCTCGGGGGCCTGAAGGAGACAACGAGCTTGAGTAAATGACCAAATAAATC
AAAGCCTCTAAATTGCGCTAACGCTTTCTAGGTCTTGATATCCAACTGAAGATTCTACAATCTCTGCCTTCGCTT
TTGCAATTTTATTCCAATGAATTGAGCGGGGAGCTTCTTGCGAATACGTTGGAAATATGCGCCACATTACAGGCA
AGCAAAACGATTGCAGTCTCTAGTACTGCCGCGGCTACTCTCCAACAGCTGGTGGTATCGACCTTTGAAAGAGTT
TCGAGCGAAGACAGCCTTCCGAAGGATGTCAAAATCACCACAACCATCAAAGTCGATGGTCAGTCGCTCGACATC
GGCTACTTCGCCTATGATGCACTGCAAGTATTGGATGATCTCTGTCGTCTGATTGATGGTGAGCCACTACAGTTT
CTGCGAACACGAACCCTACCCCCGACCTTTGTACTCGAACTTATCGAGAGTATTCTCTTGAACAGCGGCCGTCTT
TTTGTGGGACATCCCGAACTTTCGCAAGTGCTGCGCGTTCGGTTGTTACCACTAGCCGTCCGTTGTCTATCTGAG
AGGTATTCATTCGCTCAAACCGTCCGAGTCGCTCGAATTCTTCTCATTCTTCTGAAGCGTCATATGTCTCTCTTG
CCCACAGAATGTGAGATGGCATTGAGTCTGATAACCCATCTCGTTGAACCGGATGGGACAGCGCCTTGGAAGAGA
CTACTCTGCATGGAAATCTTCCGAGGGCTATACTCGGAGCCGGGTACTGTGCGGCTGATCTACACTTTGTATGAC
AGTGAGGAAGGCAGAAAGAACATCCTTCGTGACCACATGGCGGCACTTGTTCGGCTAGCTTCGGAGAAGCCTTCG
TTGATTGGTGTCAGTAATCAATCAACGGTACCTTCACGTGCAGAGCACTCAAGATCAACCACAGAGGATCAGATA
ACTCTTGAAACTGGCGGTGTTGCTGGTGTCATTGGATCAACTGTTCCTCCAAGTGAAACCAAGGTGCCTGGAATT
AGCACTCAGTGGAGTGTTGTTCGTACGCCATATATCGATCTCCTCGACAAGACGGAACCGCCCACACCGCCGGAC
ACCTACATTTACAGCCTGGTCCTTAATTGTATCAGCAGCTTTGCTGAAGGGCTCGCGAAATTCATTCTTCCATTA
ACGGTCCCGGATCTCAAGCAAAGACGCAAGAATCGACTTATGAGCCCCGTTCAGGGACCCGACTCCGCTAGATCT
TCTCAAGATTTTCCAGCAGAACCCATGCGAGCGCAGTCTAGCTCATCATCGAAAAAATCACATGTTCCCATCAAT
CCTCTGGACCTGCAGTCTCATGTACAGTACTCCGCCATCAAGACTTGCGCGGGGATAATAGAGAACTGTTGGCCC
GCTGTCCTAGCAGCTTGTTCCACCTTTTTGCGCGCATCTTTAGATGACGAGTATTACCATAATCTTGTTCGAGCA
TTCCAAAAGCTAGCTCATGTGGCGGGTCTTCTGAGATTATCCGTTCCCCGAGATGCTTTCTTAACAACTCTTGGA
AAGGCTGCTACGCCTGTGAGTGGTGCCAAGTCACACAATGTGTCTGCCACCGGCTCCCAGCAAAGTGACACACCC
CAAAAGAAACGGAGAAGTGCGGATCTGTCAAGTCTGGCCAGTTCTTTATCACTGGAGCCTACTGCGGTGGAAGGT
CCTCCTGTGTCTTTAAGTACGAGAAACCTACTTTGTATGCGGGCTTTGCTTAACCTCGGAATTGCTTTGGGGCCG
ACATTGGATCAGCCGGCCTGGTCTATTATTTTTGAAACACTTCAATATACTGGACTGGTGATTGGCATGTCCTCA
AGTGCAATGGTCAAATCGGCTAGCGGTACTGGGGAGACTCCAGTCACCCCAGGAAACGATGTTCCAACTGCCAAT
CTTGGGACTGAGGTGATTGCGGTTCAGGCGGCTTCTAACAAAATGCTCGAAAGCACCAGCGATTTCCCAAGTGCA
TCTTTTGAAGAAATATTACTTGCCTTGTTGAATCTGTCAGCATTCACCGAACAGTGTCGCAACATGAATGATGCC
CCAGGAGTATCAGACATACCTCGAACACCGCAATCACCCCAGGCAGGTGGACGCTTGCACCAAGGTTCCCGGCGC
GTATCGCATACTGTCGGAAAATCAAGAATGCAAGACGAGGAACTCAAATTTGTATTGGAGAAAGCAAATGAACTA
GCCAAGGCAAATCTTGGGAGACTGTCTTCGCTCGAGAAAGATGACAGCAAAGCATGGGAGCTACTGACGCAAAGT
CTCATCTCTACTTCCGCAAATACTACCGTCAGTCCGAATCTTCGCCTGCAGGCAAGCGCGATTTTGAACTCGATC
GTATTCTCAACAATGAAACAAAGGGACGAAGACGATGAGAAAGTCTACAATCAAGTGCAGACGAGGAATCTGCAG
ACATTGAAAGCCCAGGTCGCCTCGCTCTATGCATCGGACATGCACACGTCCAAGTCTTTGCCAATAACCGTCATT
GAAATCCACGAACAGACCTTGGAAGTGTTAAATAATATTCTGGAACAGTATGCAGAAACTTTCGTGGACGGATGG
AACCTCATCTTTGATTTAATATCTGGTGTTTTTCAACATGCCCCAGATCCTGGACCTGGCGATCGGCCTTCTACT
CTGATAGAGCGCAGATCATCGGCTCTTCCAGCAGGCCCCCGGTTGGTACGTGCTGCCTATAAGTCTTTGCATCTT
GTCGCATCCGACTTCCTTTCTCTGCTACCAGCGCCCTGTCTCTTAAGCTTGGTGAATGCCTTCTCTAGCTTTACG
TCGCAAACCCAAGATTTCAATATCTCCCTCACCACCACCTCGTTTTTCTGGAACGTTTCGGACTTTCTCCAGGCC
CAAATTGAGCAAATCTCAGTTGACCATGTTGATGCGTCTGTCAGCGAAGAAGAAATAGCTAAACTAGCACATAAC
CAAGACCCTTCTGTTTCCCGGAACTCGCTGTGGCTGCTGCTGCTGCTTCGCATCGTTGATATCACGACAGATAGT
CGACCTGAGGTTCGAAACAGTGCAGTCCATACGCTTCTACGCATCTTCGACGCCTATGGGCAGCAGCTCTCCCCC
GAGGCGTGGCGTCTGTGCCTAAACATGGTTCTCTTCAAGATGGCTGAGGGAATTGAGACCCCTCTCCTCCAAGCG
AAGAACAACCGAAGCAGTACAAAACCTGATGACTTCAAGGCGTGGGTGGATACAACAGTGGTGATGATCAAGGGT
TTATCAACTCTGATCAAGAATTTCTTCGAGACCCTTGTGCACGACGAGAAGTTCGATCAATCCTGGAAGCGACTT
TTGAAGTACCTGCAAAGTCTGATTGACTTGCATATTTTGGATTTCAGCGAAGCAACATTTTCTAGCCTCTCTACG
ATCCTCCTCCGGGTGCAGAATGGATGTGAACTTAGCAACGATGCTCTTGAGTGTGCGTGGCTTCTATGGGCAAAT
GGCCACCCTGCTAGCGACGAGAAGGCGCTTGACTTAGATCAACCTAACCAGGACGCGGCTTTGGCTTATCTACAT
ACATTCCAACAGATCTATCGTCTTTACAAAGATCAGTTGAGTACGGGACACATTGAAAACGTCCTTCATCATCTC
AGTTTGCTGGTGTGGAACTCGGTCTCCCCGCGCTACTCTCCAGATATCGATCGACCCTCGGCCTTGCAAGCGCTA
GTCATTGATTGTGTCAAAACGCTCTGCCTGGAGAAAGAGGACTCCCAGCCGAATATTCTCTTGTGTCTTGCCGAA
TTATCCGATTCAGCATTATCCAAATGGAGCCCCGGCAGCGACACTCGAAGACCAGGATTCGTGGCCTTCTCGAAA
CGCACTATCGATCTTGTCAGCTGGTACATTGCCGAATTCGGCATCAAGCAAAACGTCTTCATGAATGGTGCTCTT
GCAAAATCACTCGAACACCTCAGTACTCTAATTGCGGAAAAGTACACATGGCAAGGGAAGGATCGCGAGCCGTTC
CTATGGCAAAAGGCCACAACAGTATCTCTGAACGTTCTGCAAGTCGCTGTCCCCTACGTGGAAAAGCAATACACG
AAGGCAAACGAGTCCGAAACATCTCAGTTCTGGCAACATATTGTTAGCATTACAAACGGAATTGTTTCCGCCCGT
GGCTTCCAAACCCAACAACTCCCCAACGCCCGAATCCTCACAGACGAAGCATTCGACATCAAAGCCTTCACCCGC
CTGAAGACCCTCATCCTCCCATCCCTCGGCGCAGCAGCAATCCCGGACGCCGTCCGCCGCGATTTCGCCCGCGCT
CTCTTCAACTCCTCCTTCATCTACGCTCCCCTCCGCTTCGACCTACCCACCGGCCTCGAAGACGCACCCCTACAG
GACTTCTATACCGTCCGCCCCGGCCGCACCTTCGACCCACCGCCGACCCTGCGCCCGGGAATAGCCTATGTCCTT
CTAGACACGCTCTTCGAGCTCGCCGCACACTCGCAAGCCGAGACCGAGACAAAAGCCGACGCTCCATCCCCGCAG
ACTCTGCTCGCCCGCTCGATCTCGCCCTATCTCCTTCTGCGCTGCGCGGTCTCGCTCAAGTCTTACATTGCAGAC
CAGCCTTTGCGTGGCTTGATGCCCCAACCCACGCCTGCCCGCAAGGCCCTGCTCCATCTGCTCGTCCGCATGGTC
GAGCTGAAGAGTGAGCCGTCGGCTATCCCGGATCCGCCTTCGCTGAAGACCATCTCGGGTATCTCGGGTGAGGAT
CCGGAGGAGCATCACTATCGGAAGCATCTCGAGTGGATTTATCCGTTGGTTGTGCGCGCTGTGCAGGTTGCTGGC
AAGGAGCGCGATGATGGGCAGATTCTCCAGGCGCTGGGGAAGGTGTTGCAGGAAATTGGTCGGTTTGAGTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail