Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3606.t1
Gene name
Locationscaffold_06:209014..210623
Strand+
Gene length (bp)1609
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain) 7.2E-78 242 473
PF00364 Biotin_lipoyl Biotin-requiring enzyme 2.0E-13 53 120
PF02817 E3_binding e3 binding domain 6.1E-11 180 214

GO

GO Term Description Terminal node
GO:0016746 transferase activity, transferring acyl groups Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3606.t1
MGFSRSGGLAARNFRPCLPQNHLRIRSTLPPLLSRKFHASSLLWQIKSQVLKDVGEGITEVQIIQWYVEEGAHIE
EWKPLCQYQSDKAVDDITSRYEGVIKKLHFETDDTVPTGRALCDIEVADGKYPDDNPAHESRAAPSEPTPASEIQ
AATQAVESSLITPPPIKALDEIPKTKHASLAVPAVRGLLKSHGVNILEINGTGKDGRVMKEDVLKFVAERDSPAL
PTSVPTSVSVSPDTRQAESIVNLTPIQSQMFKTMTKSLNIPHFLYADELKINDINAIRKKIAFDKHDPTKITFLP
FVVKAVSQALTEFPILNSKVDTTDPAKPKLVMRSKHNIGIAMDTPNGLIVPNIKDVASRSIFDIAAEIARLSALG
KSGKLTPADLSGGTITVSNIGNIGGTYVAPVLVPTEVAILGVGRTRAVPIFDDDGQVTRGDMVNFSWSADHRVID
GATMAKMGNRVKDLVESPELMLLNLR*
Coding >Pro_DTO377G3_2|g3606.t1
ATGGGTTTCAGCCGCAGTGGGGGACTTGCTGCCCGCAACTTCAGACCTTGTCTACCCCAGAATCACCTCCGCATT
CGCTCCACCCTACCTCCGCTCTTGTCCCGAAAATTCCATGCCAGCTCTCTGCTATGGCAGATCAAATCACAAGTT
CTCAAGGACGTCGGCGAGGGCATCACTGAGGTCCAGATCATCCAGTGGTACGTAGAAGAAGGGGCTCATATTGAG
GAATGGAAACCTTTGTGCCAATACCAGTCGGATAAAGCTGTCGATGATATTACATCGAGATATGAGGGTGTAATC
AAGAAACTACACTTCGAGACAGACGATACAGTACCTACGGGAAGGGCACTCTGCGACATCGAGGTTGCGGATGGA
AAATACCCCGATGATAACCCGGCGCACGAATCAAGGGCAGCGCCGTCTGAACCTACCCCGGCTTCTGAGATCCAA
GCTGCAACTCAAGCAGTCGAATCCTCTCTAATAACCCCTCCCCCTATCAAAGCTCTTGATGAGATACCCAAAACG
AAGCATGCATCCCTTGCAGTTCCCGCAGTACGTGGGCTATTGAAAAGCCACGGCGTGAACATCCTCGAAATCAAC
GGAACCGGAAAAGACGGGCGGGTGATGAAAGAAGATGTACTGAAGTTTGTAGCAGAGAGAGATTCTCCAGCGCTT
CCAACATCAGTGCCCACCTCAGTCTCCGTGTCACCGGACACACGGCAAGCAGAGTCAATTGTCAACCTGACTCCG
ATCCAATCACAGATGTTCAAAACAATGACCAAATCCCTGAACATTCCACACTTCCTTTACGCAGACGAACTCAAA
ATCAACGACATCAATGCCATCCGCAAGAAAATTGCCTTTGACAAACACGATCCTACCAAAATCACCTTCCTCCCT
TTCGTCGTCAAGGCCGTCTCACAGGCTCTGACCGAGTTCCCAATTCTCAACTCCAAAGTCGATACCACGGACCCC
GCAAAGCCGAAGCTAGTCATGCGCTCCAAGCACAATATCGGAATTGCTATGGATACACCGAATGGTCTGATTGTT
CCGAATATCAAGGACGTCGCCAGTCGCTCGATCTTCGACATTGCTGCTGAGATCGCGCGGCTGAGTGCCCTTGGG
AAGAGCGGAAAGCTGACCCCCGCTGATCTCAGTGGTGGCACGATCACCGTGTCGAACATCGGCAATATTGGAGGC
ACATACGTAGCTCCGGTGCTTGTGCCAACGGAGGTGGCTATTCTCGGCGTGGGTAGGACTAGAGCTGTGCCCATC
TTTGATGACGATGGACAGGTGACACGCGGAGATATGGTTAACTTCAGTTGGAGCGCGGATCACCGCGTCATTGAC
GGTGCGACAATGGCCAAAATGGGTAACAGGGTTAAGGACCTGGTTGAGTCGCCCGAGCTTATGCTTCTAAATCTC
AGGTGA
Transcript >Pro_DTO377G3_2|g3606.t1
ATGGGTTTCAGCCGCAGTGGGGGACTTGCTGCCCGCAACTTCAGACCTTGTCTACCCCAGAATCACCTCCGCATT
CGCTCCACCCTACCTCCGCTCTTGTCCCGAAAATTCCATGCCAGCTCTCTGCTATGGCAGATCAAATCACAAGTT
CTCAAGGACGTCGGCGAGGGCATCACTGAGGTCCAGATCATCCAGTGGTACGTAGAAGAAGGGGCTCATATTGAG
GAATGGAAACCTTTGTGCCAATACCAGTCGGATAAAGCTGTCGATGATATTACATCGAGATATGAGGGTGTAATC
AAGAAACTACACTTCGAGACAGACGATACAGTACCTACGGGAAGGGCACTCTGCGACATCGAGGTTGCGGATGGA
AAATACCCCGATGATAACCCGGCGCACGAATCAAGGGCAGCGCCGTCTGAACCTACCCCGGCTTCTGAGATCCAA
GCTGCAACTCAAGCAGTCGAATCCTCTCTAATAACCCCTCCCCCTATCAAAGCTCTTGATGAGATACCCAAAACG
AAGCATGCATCCCTTGCAGTTCCCGCAGTACGTGGGCTATTGAAAAGCCACGGCGTGAACATCCTCGAAATCAAC
GGAACCGGAAAAGACGGGCGGGTGATGAAAGAAGATGTACTGAAGTTTGTAGCAGAGAGAGATTCTCCAGCGCTT
CCAACATCAGTGCCCACCTCAGTCTCCGTGTCACCGGACACACGGCAAGCAGAGTCAATTGTCAACCTGACTCCG
ATCCAATCACAGATGTTCAAAACAATGACCAAATCCCTGAACATTCCACACTTCCTTTACGCAGACGAACTCAAA
ATCAACGACATCAATGCCATCCGCAAGAAAATTGCCTTTGACAAACACGATCCTACCAAAATCACCTTCCTCCCT
TTCGTCGTCAAGGCCGTCTCACAGGCTCTGACCGAGTTCCCAATTCTCAACTCCAAAGTCGATACCACGGACCCC
GCAAAGCCGAAGCTAGTCATGCGCTCCAAGCACAATATCGGAATTGCTATGGATACACCGAATGGTCTGATTGTT
CCGAATATCAAGGACGTCGCCAGTCGCTCGATCTTCGACATTGCTGCTGAGATCGCGCGGCTGAGTGCCCTTGGG
AAGAGCGGAAAGCTGACCCCCGCTGATCTCAGTGGTGGCACGATCACCGTGTCGAACATCGGCAATATTGGAGGC
ACATACGTAGCTCCGGTGCTTGTGCCAACGGAGGTGGCTATTCTCGGCGTGGGTAGGACTAGAGCTGTGCCCATC
TTTGATGACGATGGACAGGTGACACGCGGAGATATGGTTAACTTCAGTTGGAGCGCGGATCACCGCGTCATTGAC
GGTGCGACAATGGCCAAAATGGGTAACAGGGTTAAGGACCTGGTTGAGTCGCCCGAGCTTATGCTTCTAAATCTC
AGGTGA
Gene >Pro_DTO377G3_2|g3606.t1
ATGGGTTTCAGCCGCAGTGGGGGACTTGCTGCCCGCAACTTCAGACCTTGTCTACCCCAGAATCACCTCCGCATT
CGCTCCACCCTACCTCCGCTCTTGTCCCGAAAATTCCATGCCAGCTCTCTGCTATGGCAGATCAAATCACAAGTT
CTCAAGGACGTCGGCGAGGGTAATTTATTCATAATCCTAACTCATTCCTCAATTTGTTCACTTACAATTACCAGG
CATCACTGAGGTCCAGATCATCCAGTGGTACGTAGAAGAAGGGGCTCATATTGAGGAATGGAAACCTTTGTGCCA
ATACCAGTCGGATAAAGCTGTCGATGATGTGGGTGCTGCCTCCTTTGTTCCCTGCTATGGGTTAACGACTAACAA
ACCCAGATTACATCGAGATATGAGGGTGTAATCAAGAAACTACACTTCGAGACAGACGATACAGTACCTACGGGA
AGGGTATGTACTACCTTCACTCTTGCTTGTCTGAAAGTCAGACTGCAGTCAACGTACTAACAGGCTTCGATAGGC
ACTCTGCGACATCGAGGTTGCGGATGGAAAATACCCCGATGATAACCCGGCGCACGAATCAAGGGCAGCGCCGTC
TGAACCTACCCCGGCTTCTGAGATCCAAGCTGCAACTCAAGCAGTCGAATCCTCTCTAATAACCCCTCCCCCTAT
CAAAGCTCTTGATGAGATACCCAAAACGAAGCATGCATCCCTTGCAGTTCCCGCAGTACGTGGGCTATTGAAAAG
CCACGGCGTGAACATCCTCGAAATCAACGGAACCGGAAAAGACGGGCGGGTGATGAAAGAAGATGTACTGAAGTT
TGTAGCAGAGAGAGATTCTCCAGCGCTTCCAACATCAGTGCCCACCTCAGTCTCCGTGTCACCGGACACACGGCA
AGCAGAGTCAATTGTCAACCTGACTCCGATCCAATCACAGATGTTCAAAACAATGACCAAATCCCTGAACATTCC
ACACTTCCTTTACGCAGACGAACTCAAAATCAACGACATCAATGCCATCCGCAAGAAAATTGCCTTTGACAAACA
CGATCCTACCAAAATCACCTTCCTCCCTTTCGTCGTCAAGGCCGTCTCACAGGCTCTGACCGAGTTCCCAATTCT
CAACTCCAAAGTCGATACCACGGACCCCGCAAAGCCGAAGCTAGTCATGCGCTCCAAGCACAATATCGGAATTGC
TATGGATACACCGAATGGTCTGATTGTTCCGAATATCAAGGACGTCGCCAGTCGCTCGATCTTCGACATTGCTGC
TGAGATCGCGCGGCTGAGTGCCCTTGGGAAGAGCGGAAAGCTGACCCCCGCTGATCTCAGTGGTGGCACGATCAC
CGTGTCGAACATCGGCAATATTGGAGGCACATACGTAGCTCCGGTGCTTGTGCCAACGGAGGTGGCTATTCTCGG
CGTGGGTAGGACTAGAGCTGTGCCCATCTTTGATGACGATGGACAGGTGACACGCGGAGATATGGTTAACTTCAG
TTGGAGCGCGGATCACCGCGTCATTGACGGTGCGACAATGGCCAAAATGGGTAACAGGGTTAAGGACCTGGTTGA
GTCGCCCGAGCTTATGCTTCTAAATCTCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail