Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3603.t1
Gene name
Locationscaffold_06:203896..204779
Strand-
Gene length (bp)883
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 1.1E-11 4 52
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 5.0E-11 61 106
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 8.2E-14 116 158
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 2.0E-12 7 69
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 9.7E-09 64 112
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 2.3E-10 117 171

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 17.66 7.03 28.29
5d_25C Five days - 25 degrees Celsius 12.74 4.40 21.09
7d_25C Seven days - 25 degrees Celsius 8.88 2.39 15.37
10d_25C Ten days - 25 degrees Celsius 8.30 2.15 14.46
7d_15C Seven days - 15 degrees Celsius 13.01 4.32 21.69
7d_30C Seven days - 30 degrees Celsius 8.33 2.22 14.45

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.409496 no
3d_25C 7d_25C 0.066303 no
3d_25C 7d_15C 0.440220 no
3d_25C 7d_30C 0.039348 yes
3d_25C 10d_25C 0.041798 yes
5d_25C 7d_25C 0.406718 no
5d_25C 7d_15C 0.973164 no
5d_25C 7d_30C 0.312138 no
5d_25C 10d_25C 0.300794 no
7d_25C 7d_15C 0.372732 no
7d_25C 7d_30C 0.923002 no
7d_25C 10d_25C 0.913162 no
7d_15C 7d_30C 0.278780 no
7d_15C 10d_25C 0.269326 no
7d_30C 10d_25C 0.996826 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3603.t1
MSPRRPWSKSEDEKLIKLIGQFGDQRGRNSKWQEISRNLPGRTNKDCRKRWFHSLDPSLRKGRWTKDEDRLLLDA
YQRIGPAWKDIALLIKGRKDDQCAKRYNDILNPQVQNRLKVWTPEEDQYLAAKVKQLGHKWTVIAAGLPGRPPLT
CRNRWRKLARNICSDIGFSQENSPMPQSSTENSRTSPSSQNSEIFISSPDASSDPTTIDLLDASLASTALPSDSS
PLDVMSYHQFRDRWNLLYGLASAPGKR*
Coding >Pro_DTO377G3_2|g3603.t1
ATGTCTCCTCGACGTCCCTGGTCTAAATCGGAAGACGAAAAATTGATCAAGCTCATCGGGCAGTTTGGGGACCAA
CGGGGCAGAAACAGCAAATGGCAAGAGATCTCCAGAAATTTACCCGGGAGAACGAATAAGGATTGTCGGAAGCGT
TGGTTTCATTCTTTAGATCCTTCTCTTCGCAAAGGACGCTGGACAAAGGATGAAGATAGGCTCTTGCTTGATGCC
TATCAACGAATTGGGCCTGCTTGGAAGGATATAGCACTTCTCATCAAAGGACGAAAGGATGATCAATGTGCGAAA
AGATACAATGACATCCTTAATCCACAAGTGCAAAATCGTCTCAAAGTCTGGACACCCGAGGAAGATCAATATTTG
GCGGCCAAAGTGAAACAACTGGGTCATAAATGGACTGTCATTGCAGCAGGCCTACCTGGTCGTCCTCCGCTGACC
TGCCGGAATCGATGGAGAAAACTGGCCAGAAATATCTGTAGTGACATTGGTTTCTCTCAGGAAAATTCGCCAATG
CCCCAATCCTCTACGGAGAATTCAAGGACTTCGCCGTCGTCTCAGAACTCCGAGATCTTCATTTCGTCTCCTGAC
GCATCGTCTGACCCCACCACTATCGACCTCCTAGATGCCTCTCTGGCATCTACCGCTCTGCCTTCTGATTCTTCC
CCTTTGGATGTCATGTCATATCATCAATTCCGTGATCGTTGGAATCTCCTATACGGACTGGCCAGCGCACCAGGC
AAGCGCTAA
Transcript >Pro_DTO377G3_2|g3603.t1
ATGTCTCCTCGACGTCCCTGGTCTAAATCGGAAGACGAAAAATTGATCAAGCTCATCGGGCAGTTTGGGGACCAA
CGGGGCAGAAACAGCAAATGGCAAGAGATCTCCAGAAATTTACCCGGGAGAACGAATAAGGATTGTCGGAAGCGT
TGGTTTCATTCTTTAGATCCTTCTCTTCGCAAAGGACGCTGGACAAAGGATGAAGATAGGCTCTTGCTTGATGCC
TATCAACGAATTGGGCCTGCTTGGAAGGATATAGCACTTCTCATCAAAGGACGAAAGGATGATCAATGTGCGAAA
AGATACAATGACATCCTTAATCCACAAGTGCAAAATCGTCTCAAAGTCTGGACACCCGAGGAAGATCAATATTTG
GCGGCCAAAGTGAAACAACTGGGTCATAAATGGACTGTCATTGCAGCAGGCCTACCTGGTCGTCCTCCGCTGACC
TGCCGGAATCGATGGAGAAAACTGGCCAGAAATATCTGTAGTGACATTGGTTTCTCTCAGGAAAATTCGCCAATG
CCCCAATCCTCTACGGAGAATTCAAGGACTTCGCCGTCGTCTCAGAACTCCGAGATCTTCATTTCGTCTCCTGAC
GCATCGTCTGACCCCACCACTATCGACCTCCTAGATGCCTCTCTGGCATCTACCGCTCTGCCTTCTGATTCTTCC
CCTTTGGATGTCATGTCATATCATCAATTCCGTGATCGTTGGAATCTCCTATACGGACTGGCCAGCGCACCAGGC
AAGCGCTAA
Gene >Pro_DTO377G3_2|g3603.t1
ATGTCTCCTCGACGTCCCTGGTCTAAATCGGAAGACGAAAAATTGATCAAGCTCATCGGGCAGTTTGGGGACCAA
CGGGGCAGAAACAGCAAATGGCAAGAGATCTCCAGAAATTTACCCGGGAGAACGAATAAGGTAGGTCCTCTTCTT
TTATGCATCGGGCTGGCGTGCCAGAGCATCGCTGATATCACCATATTCACAAGGATTGTCGGAAGCGTTGGTTTC
ATTCTTTAGATCCTTCTCTTCGCAAAGGACGCTGGACAAAGGATGAAGATAGGCTCTTGCTTGATGCCTATCAAC
GAATTGGGCCTGCTTGGAAGGATATAGGTAAGTTTTTTTCTATCCAATACTCTTACATGTCCGGCGGCTAAGTGT
ACCTCTAGCACTTCTCATCAAAGGACGAAAGGATGATCAATGTGCGAAAAGATACAATGACATCCTTAATCCACA
AGTGCAAAATCGTCTCAAAGTCTGGACACCCGAGGAAGATCAATATTTGGCGGCCAAAGTGAAACAACTGGGTCA
TAAATGGACTGTCATTGCAGCAGGCCTACCTGGTCGTCCTCCGCTGACCTGCCGGAATCGATGGAGAAAACTGGC
CAGAAATATCTGTAGTGACATTGGTTTCTCTCAGGAAAATTCGCCAATGCCCCAATCCTCTACGGAGAATTCAAG
GACTTCGCCGTCGTCTCAGAACTCCGAGATCTTCATTTCGTCTCCTGACGCATCGTCTGACCCCACCACTATCGA
CCTCCTAGATGCCTCTCTGGCATCTACCGCTCTGCCTTCTGATTCTTCCCCTTTGGATGTCATGTCATATCATCA
ATTCCGTGATCGTTGGAATCTCCTATACGGACTGGCCAGCGCACCAGGCAAGCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail