Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3576.t1
Gene name
Locationscaffold_06:137499..139661
Strand+
Gene length (bp)2162
Transcript length (bp)2106
Coding sequence length (bp)2106
Protein length (aa) 702

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04677 CwfJ_C_1 Protein similar to CwfJ C-terminus 1 9.5E-29 460 584
PF04676 CwfJ_C_2 Protein similar to CwfJ C-terminus 2 1.3E-28 593 695

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 59.29 36.42 82.16
5d_25C Five days - 25 degrees Celsius 81.12 49.50 112.74
7d_25C Seven days - 25 degrees Celsius 78.99 47.73 110.25
10d_25C Ten days - 25 degrees Celsius 102.99 62.17 143.82
7d_15C Seven days - 15 degrees Celsius 107.81 63.77 151.85
7d_30C Seven days - 30 degrees Celsius 77.82 46.98 108.66

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.154084 no
3d_25C 7d_25C 0.208650 no
3d_25C 7d_15C 0.002761 yes
3d_25C 7d_30C 0.227321 no
3d_25C 10d_25C 0.005235 yes
5d_25C 7d_25C 0.939313 no
5d_25C 7d_15C 0.218830 no
5d_25C 7d_30C 0.898669 no
5d_25C 10d_25C 0.316649 no
7d_25C 7d_15C 0.175982 no
7d_25C 7d_30C 0.966089 no
7d_25C 10d_25C 0.257263 no
7d_15C 7d_30C 0.142716 no
7d_15C 10d_25C 0.890723 no
7d_30C 10d_25C 0.217728 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3576.t1
MTLEDFEKSLADGKEPRHEKSEGRHHRDRNRDRDRSKERSRQHRHHSDHHHRRHSSRSRDRDSERVRESRHRDDD
GRRHKRSRRSDDQGDEHGHKRHHRNSKDEGKSTAPPVIVQEEPSNLKRDAWMEAPSGLDVEYVHRPDSTRQEEPK
PIMLSADYELKIHDKELNDHLRDLKDGKTLEDIEDEPAQHEVDYTFGDSGSQWRMTKLKGVYREAEESGRPIEDI
ATERFGDLRSFDDAREEETEIDRRKTYGKSYVGKDKPSGELFQERKLQNDIRRGPLEHVRDPEQELKAEGQGKKM
DTVPPPNTTRHLDMTALNRLKAQMMKAKLRKAPNAADLEEQYNTAAAAMSNRKESDVVVLDVMHNPMLAGSRNEV
KAVDTKRGRERGQVEANEDMTIEDMVREERKTRGQLGGEGRRLADQIGRDAKFENDLEYMDDNASKLAKRVHRSE
IDLKNTTINDFHKMNRILDNCPLCHNEDKGTPPLAPVVSLATRVFLTLPTEPEISEGGATIVPIQHRTNLMECDD
DEWEEIRNFMKSLTRMYHDQGRDVIFYENAAQPQRKRHASMEVVPLPYSLGETAPAFFKEAILSAESEWSQHRKL
IDTLAKSKQGLGRSAFRRTLVKEMPYFHVWFELDGGLGHIVEDDNRWPRGDLFAREIIGGMLDVAPDVIKRQGRW
NRGDRRVDGFRKRWKKFDWTRILIEG*
Coding >Pro_DTO377G3_2|g3576.t1
ATGACTCTAGAAGATTTTGAGAAATCATTGGCAGACGGGAAAGAGCCGCGACACGAGAAAAGTGAAGGGCGACAT
CATCGAGACCGAAACCGCGATCGCGATCGCAGCAAAGAGCGCTCGAGACAACACCGTCATCATTCCGACCACCAT
CACCGGCGGCATTCCTCCAGATCTCGCGATCGAGACAGCGAGCGAGTTCGCGAGTCCAGGCATCGCGACGACGAT
GGCCGCCGACACAAGCGTTCACGTCGTTCCGACGACCAAGGAGACGAACATGGCCATAAACGCCATCACCGGAAT
TCCAAAGATGAGGGCAAATCCACCGCTCCTCCGGTAATAGTACAGGAAGAGCCCAGTAATCTCAAACGGGACGCC
TGGATGGAAGCGCCCTCGGGTCTCGACGTTGAATATGTTCATCGACCGGATTCGACGCGACAGGAGGAGCCGAAA
CCAATAATGCTTTCAGCGGACTACGAACTCAAGATTCATGACAAGGAGCTCAACGACCATCTTCGTGATCTCAAA
GATGGAAAAACACTCGAAGATATAGAAGATGAACCTGCTCAGCACGAGGTGGACTATACTTTTGGGGATTCGGGG
TCACAATGGAGAATGACCAAACTCAAAGGTGTATACAGAGAGGCGGAGGAAAGTGGCAGGCCTATTGAAGATATT
GCTACTGAGCGTTTTGGAGACCTTCGCTCCTTTGACGACGCTCGGGAGGAGGAAACTGAGATTGATCGGCGCAAA
ACGTATGGCAAGTCCTATGTGGGCAAAGATAAACCTAGTGGGGAGCTGTTCCAGGAAAGGAAACTCCAAAATGAT
ATTCGAAGAGGTCCACTCGAACATGTTCGTGATCCAGAGCAGGAACTGAAGGCCGAAGGCCAAGGCAAGAAAATG
GACACTGTGCCTCCTCCGAACACTACCCGTCACCTCGATATGACGGCACTGAATCGTCTCAAAGCCCAGATGATG
AAGGCAAAGCTCAGAAAAGCACCAAATGCCGCCGATCTCGAGGAACAGTACAATACAGCCGCGGCAGCTATGTCA
AACCGCAAGGAGTCCGATGTTGTGGTCCTTGATGTTATGCATAACCCGATGCTAGCAGGCTCTAGGAATGAGGTC
AAAGCTGTCGATACTAAGAGAGGCCGGGAAAGAGGCCAGGTGGAAGCAAATGAAGATATGACCATTGAAGATATG
GTGCGCGAAGAGCGCAAGACCCGTGGCCAACTCGGCGGAGAAGGCCGGCGCCTAGCAGATCAAATTGGCCGTGAT
GCCAAGTTTGAGAACGACTTGGAGTATATGGATGACAATGCGTCCAAGTTGGCCAAAAGGGTTCATCGATCTGAG
ATTGACCTCAAGAACACAACGATCAATGACTTCCACAAGATGAACCGGATATTGGACAACTGCCCGCTTTGTCAC
AACGAAGACAAGGGCACGCCTCCTCTTGCCCCAGTGGTTTCCCTTGCGACCAGGGTCTTCCTCACACTTCCTACC
GAACCCGAAATCAGTGAAGGGGGTGCTACTATCGTACCAATCCAACATCGCACTAATTTGATGGAATGCGATGAC
GACGAGTGGGAAGAGATCCGCAACTTTATGAAGAGTCTCACGCGTATGTACCACGACCAAGGTCGAGATGTGATC
TTCTACGAGAATGCAGCCCAGCCACAGCGCAAGCGACATGCATCCATGGAAGTCGTGCCTTTACCCTACAGTCTA
GGAGAAACCGCTCCTGCGTTTTTCAAAGAGGCAATTCTCAGTGCCGAGTCGGAATGGTCGCAGCACCGCAAACTT
ATCGATACCCTTGCTAAATCAAAGCAAGGTTTAGGCCGGTCTGCCTTCCGCCGAACCCTTGTGAAGGAGATGCCC
TACTTCCACGTTTGGTTTGAACTAGATGGTGGCCTGGGTCATATTGTGGAGGACGACAACCGCTGGCCTCGTGGA
GATCTCTTTGCCCGAGAGATCATCGGTGGAATGCTGGATGTTGCACCGGACGTTATCAAACGACAAGGACGCTGG
AACCGTGGTGATCGCAGGGTTGACGGATTCAGAAAGCGCTGGAAGAAGTTTGACTGGACCCGTATTCTAATTGAA
GGCTAG
Transcript >Pro_DTO377G3_2|g3576.t1
ATGACTCTAGAAGATTTTGAGAAATCATTGGCAGACGGGAAAGAGCCGCGACACGAGAAAAGTGAAGGGCGACAT
CATCGAGACCGAAACCGCGATCGCGATCGCAGCAAAGAGCGCTCGAGACAACACCGTCATCATTCCGACCACCAT
CACCGGCGGCATTCCTCCAGATCTCGCGATCGAGACAGCGAGCGAGTTCGCGAGTCCAGGCATCGCGACGACGAT
GGCCGCCGACACAAGCGTTCACGTCGTTCCGACGACCAAGGAGACGAACATGGCCATAAACGCCATCACCGGAAT
TCCAAAGATGAGGGCAAATCCACCGCTCCTCCGGTAATAGTACAGGAAGAGCCCAGTAATCTCAAACGGGACGCC
TGGATGGAAGCGCCCTCGGGTCTCGACGTTGAATATGTTCATCGACCGGATTCGACGCGACAGGAGGAGCCGAAA
CCAATAATGCTTTCAGCGGACTACGAACTCAAGATTCATGACAAGGAGCTCAACGACCATCTTCGTGATCTCAAA
GATGGAAAAACACTCGAAGATATAGAAGATGAACCTGCTCAGCACGAGGTGGACTATACTTTTGGGGATTCGGGG
TCACAATGGAGAATGACCAAACTCAAAGGTGTATACAGAGAGGCGGAGGAAAGTGGCAGGCCTATTGAAGATATT
GCTACTGAGCGTTTTGGAGACCTTCGCTCCTTTGACGACGCTCGGGAGGAGGAAACTGAGATTGATCGGCGCAAA
ACGTATGGCAAGTCCTATGTGGGCAAAGATAAACCTAGTGGGGAGCTGTTCCAGGAAAGGAAACTCCAAAATGAT
ATTCGAAGAGGTCCACTCGAACATGTTCGTGATCCAGAGCAGGAACTGAAGGCCGAAGGCCAAGGCAAGAAAATG
GACACTGTGCCTCCTCCGAACACTACCCGTCACCTCGATATGACGGCACTGAATCGTCTCAAAGCCCAGATGATG
AAGGCAAAGCTCAGAAAAGCACCAAATGCCGCCGATCTCGAGGAACAGTACAATACAGCCGCGGCAGCTATGTCA
AACCGCAAGGAGTCCGATGTTGTGGTCCTTGATGTTATGCATAACCCGATGCTAGCAGGCTCTAGGAATGAGGTC
AAAGCTGTCGATACTAAGAGAGGCCGGGAAAGAGGCCAGGTGGAAGCAAATGAAGATATGACCATTGAAGATATG
GTGCGCGAAGAGCGCAAGACCCGTGGCCAACTCGGCGGAGAAGGCCGGCGCCTAGCAGATCAAATTGGCCGTGAT
GCCAAGTTTGAGAACGACTTGGAGTATATGGATGACAATGCGTCCAAGTTGGCCAAAAGGGTTCATCGATCTGAG
ATTGACCTCAAGAACACAACGATCAATGACTTCCACAAGATGAACCGGATATTGGACAACTGCCCGCTTTGTCAC
AACGAAGACAAGGGCACGCCTCCTCTTGCCCCAGTGGTTTCCCTTGCGACCAGGGTCTTCCTCACACTTCCTACC
GAACCCGAAATCAGTGAAGGGGGTGCTACTATCGTACCAATCCAACATCGCACTAATTTGATGGAATGCGATGAC
GACGAGTGGGAAGAGATCCGCAACTTTATGAAGAGTCTCACGCGTATGTACCACGACCAAGGTCGAGATGTGATC
TTCTACGAGAATGCAGCCCAGCCACAGCGCAAGCGACATGCATCCATGGAAGTCGTGCCTTTACCCTACAGTCTA
GGAGAAACCGCTCCTGCGTTTTTCAAAGAGGCAATTCTCAGTGCCGAGTCGGAATGGTCGCAGCACCGCAAACTT
ATCGATACCCTTGCTAAATCAAAGCAAGGTTTAGGCCGGTCTGCCTTCCGCCGAACCCTTGTGAAGGAGATGCCC
TACTTCCACGTTTGGTTTGAACTAGATGGTGGCCTGGGTCATATTGTGGAGGACGACAACCGCTGGCCTCGTGGA
GATCTCTTTGCCCGAGAGATCATCGGTGGAATGCTGGATGTTGCACCGGACGTTATCAAACGACAAGGACGCTGG
AACCGTGGTGATCGCAGGGTTGACGGATTCAGAAAGCGCTGGAAGAAGTTTGACTGGACCCGTATTCTAATTGAA
GGCTAG
Gene >Pro_DTO377G3_2|g3576.t1
ATGACTCTAGAAGATTTTGAGAAATCATTGGCAGACGGGAAAGAGCCGCGACACGAGAAAAGTGAAGGGCGACAT
CATCGAGACCGAAACCGCGATCGCGATCGCAGCAAAGAGCGCTCGAGACAACACCGTCATCATTCCGACCACCAT
CACCGGCGGCATTCCTCCAGATCTCGCGATCGAGACAGCGAGCGAGTTCGCGAGTCCAGGCATCGCGACGACGAT
GGCCGCCGACACAAGCGTTCACGTCGTTCCGACGACCAAGGAGACGAACATGGCCATAAACGCCATCACCGGAAT
TCCAAAGATGAGGGCAAATCCACCGCTCCTCCGGTAATAGTACAGGAAGAGCCCAGTAATCTCAAACGGGACGCC
TGGATGGAAGCGCCCTCGGGTCTCGACGTTGAATATGTTCATCGACCGGATTCGACGCGACAGGAGGAGCCGAAA
CCAATAATGCTTTCAGCGGACTACGAACTCAAGATTCATGACAAGGAGCTCAACGACCATCTTCGTGATCTCAAA
GATGGAAAAACACTCGAAGATATAGAAGATGAACCTGCTCAGCACGAGGTGGACTATACTTTTGGGGATTCGGGG
TCACAATGGAGAATGACCAAACTCAAAGGTGTATACAGAGAGGCGGAGGAAAGTGGCAGGCCTATTGAAGATATT
GCTACTGAGCGTTTTGGAGACCTTCGCTCCTTTGACGACGCTCGGGAGGAGGAAACTGAGATTGATCGGCGCAAA
ACGTATGGCAAGTCCTATGTGGGCAAAGATAAACCTAGTGGGGAGCTGTTCCAGGAAAGGAAACTCCAAAATGAT
ATTCGAAGAGGTCCACTCGAACATGTTCGTGATCCAGAGCAGGAACTGAAGGCCGAAGGCCAAGGCAAGAAAATG
GACACTGTGCCTCCTCCGAACACTACCCGTCACCTCGATATGACGGCACTGAATCGTCTCAAAGCCCAGATGATG
AAGGCAAAGCTCAGAAAAGCACCAAATGCCGCCGATCTCGAGGAACAGTACAATACAGCCGCGGCAGCTATGTCA
AACCGCAAGGAGTCCGATGTTGTGGTCCTTGATGTTATGCATAACCCGATGCTAGCAGGCTCTAGGAATGAGGTC
AAAGCTGTCGATACTAAGAGAGGCCGGGAAAGAGGCCAGGTGGAAGCAAATGAAGATATGACCATTGAAGATATG
GTGCGCGAAGAGCGCAAGACCCGTGGCCAACTCGGCGGAGAAGGCCGGCGCCTAGCAGATCAAATTGGCCGTGAT
GCCAAGTTTGAGGTCAGTCCTAGACTTATGTGTGATGACTCCTGTTTCCCCTGCTAACCAATGTATAGAACGACT
TGGAGTATATGGATGACAATGCGTCCAAGTTGGCCAAAAGGGTTCATCGATCTGAGATTGACCTCAAGAACACAA
CGATCAATGACTTCCACAAGATGAACCGGATATTGGACAACTGCCCGCTTTGTCACAACGAAGACAAGGGCACGC
CTCCTCTTGCCCCAGTGGTTTCCCTTGCGACCAGGGTCTTCCTCACACTTCCTACCGAACCCGAAATCAGTGAAG
GGGGTGCTACTATCGTACCAATCCAACATCGCACTAATTTGATGGAATGCGATGACGACGAGTGGGAAGAGATCC
GCAACTTTATGAAGAGTCTCACGCGTATGTACCACGACCAAGGTCGAGATGTGATCTTCTACGAGAATGCAGCCC
AGCCACAGCGCAAGCGACATGCATCCATGGAAGTCGTGCCTTTACCCTACAGTCTAGGAGAAACCGCTCCTGCGT
TTTTCAAAGAGGCAATTCTCAGTGCCGAGTCGGAATGGTCGCAGCACCGCAAACTTATCGATACCCTTGCTAAAT
CAAAGCAAGGTTTAGGCCGGTCTGCCTTCCGCCGAACCCTTGTGAAGGAGATGCCCTACTTCCACGTTTGGTTTG
AACTAGATGGTGGCCTGGGTCATATTGTGGAGGACGACAACCGCTGGCCTCGTGGAGATCTCTTTGCCCGAGAGA
TCATCGGTGGAATGCTGGATGTTGCACCGGACGTTATCAAACGACAAGGACGCTGGAACCGTGGTGATCGCAGGG
TTGACGGATTCAGAAAGCGCTGGAAGAAGTTTGACTGGACCCGTATTCTAATTGAAGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail