Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3575.t1
Gene name
Locationscaffold_06:135983..137255
Strand-
Gene length (bp)1272
Transcript length (bp)1206
Coding sequence length (bp)1206
Protein length (aa) 402

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein 3.0E-72 9 273

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3575.t1
MASPVAVVCVGMAGSGKTTFMQRINSYLHEKKTVPYVINLDPAVHSVPFESNIDIRDSINYKEVMKQYNLGPNGG
ILTSLNLFATKVDQIISLLEKRTAPNPENPSATPIKHILVDTPGQIEVFVWSASGSILLETMATSFPTVIAYVID
TPRASSTSTFMSNMLYACSILYKTKLPMILVFNKTDVKDAEFAKEWMTDFDAFQQALRQEEDAGAFGAEGGAGGF
GSGSGYMGSLLNSMSLMLEEFYRHLSVVGVSSMTGDGVEEFFEAVETKRQEFERDYKPELERKKKEREEQSSSQR
ELELGKLMKDMNVSGSSRQPPRKPTEEPETVSEAEDEEDDIIKRGLADGEDSDYEDYVGPNAGNDEGLTQRYQEA
LAGSQSTPSEQDNSFTRYLRASNMQQ*
Coding >Pro_DTO377G3_2|g3575.t1
ATGGCATCTCCGGTGGCCGTGGTCTGCGTGGGCATGGCAGGCTCAGGCAAGACGACCTTCATGCAAAGAATCAAC
TCCTATCTGCATGAAAAGAAGACCGTGCCGTATGTGATCAATCTCGACCCCGCGGTGCATTCGGTACCCTTCGAG
AGCAACATCGATATCCGTGACTCCATTAATTACAAAGAAGTGATGAAGCAGTACAACCTGGGTCCTAACGGAGGA
ATTTTGACTTCATTAAATCTGTTCGCCACCAAAGTCGATCAAATTATCTCGCTCCTAGAGAAACGCACCGCCCCG
AACCCTGAAAACCCTTCCGCAACACCAATCAAGCACATCTTGGTCGACACACCCGGCCAAATCGAAGTCTTTGTC
TGGAGTGCATCGGGCAGTATCCTTCTCGAGACTATGGCGACATCATTCCCAACGGTCATCGCATATGTTATCGAT
ACGCCTCGCGCAAGCTCTACCAGCACCTTCATGAGCAACATGCTGTACGCATGTAGTATCTTGTACAAGACCAAG
CTCCCCATGATCTTGGTCTTCAACAAGACTGACGTCAAGGATGCTGAGTTTGCCAAGGAATGGATGACCGACTTT
GATGCATTCCAGCAGGCTCTGCGGCAGGAGGAAGACGCGGGGGCCTTTGGAGCTGAGGGCGGTGCCGGTGGCTTT
GGTTCTGGCAGTGGATACATGGGCTCCCTTCTGAACAGCATGAGTCTCATGTTGGAAGAATTCTATCGACACCTC
AGCGTCGTTGGCGTCAGCTCAATGACGGGCGATGGTGTCGAGGAGTTCTTCGAGGCTGTGGAGACAAAGCGACAG
GAGTTTGAACGTGACTACAAGCCCGAATTGGAGCGCAAGAAGAAAGAGCGCGAAGAGCAATCATCATCCCAGCGG
GAGCTTGAACTTGGAAAATTAATGAAAGACATGAATGTGTCTGGGTCAAGCCGGCAGCCGCCGAGGAAACCCACC
GAGGAGCCTGAGACTGTCAGTGAAGCCGAAGATGAAGAAGATGATATCATCAAGCGTGGATTGGCAGATGGAGAA
GACAGTGACTATGAGGACTACGTGGGGCCTAACGCTGGCAATGATGAGGGTCTTACTCAACGTTACCAGGAGGCT
CTGGCAGGCTCACAAAGTACTCCATCAGAGCAGGATAACAGCTTCACAAGATATCTGCGCGCAAGCAATATGCAA
CAGTGA
Transcript >Pro_DTO377G3_2|g3575.t1
ATGGCATCTCCGGTGGCCGTGGTCTGCGTGGGCATGGCAGGCTCAGGCAAGACGACCTTCATGCAAAGAATCAAC
TCCTATCTGCATGAAAAGAAGACCGTGCCGTATGTGATCAATCTCGACCCCGCGGTGCATTCGGTACCCTTCGAG
AGCAACATCGATATCCGTGACTCCATTAATTACAAAGAAGTGATGAAGCAGTACAACCTGGGTCCTAACGGAGGA
ATTTTGACTTCATTAAATCTGTTCGCCACCAAAGTCGATCAAATTATCTCGCTCCTAGAGAAACGCACCGCCCCG
AACCCTGAAAACCCTTCCGCAACACCAATCAAGCACATCTTGGTCGACACACCCGGCCAAATCGAAGTCTTTGTC
TGGAGTGCATCGGGCAGTATCCTTCTCGAGACTATGGCGACATCATTCCCAACGGTCATCGCATATGTTATCGAT
ACGCCTCGCGCAAGCTCTACCAGCACCTTCATGAGCAACATGCTGTACGCATGTAGTATCTTGTACAAGACCAAG
CTCCCCATGATCTTGGTCTTCAACAAGACTGACGTCAAGGATGCTGAGTTTGCCAAGGAATGGATGACCGACTTT
GATGCATTCCAGCAGGCTCTGCGGCAGGAGGAAGACGCGGGGGCCTTTGGAGCTGAGGGCGGTGCCGGTGGCTTT
GGTTCTGGCAGTGGATACATGGGCTCCCTTCTGAACAGCATGAGTCTCATGTTGGAAGAATTCTATCGACACCTC
AGCGTCGTTGGCGTCAGCTCAATGACGGGCGATGGTGTCGAGGAGTTCTTCGAGGCTGTGGAGACAAAGCGACAG
GAGTTTGAACGTGACTACAAGCCCGAATTGGAGCGCAAGAAGAAAGAGCGCGAAGAGCAATCATCATCCCAGCGG
GAGCTTGAACTTGGAAAATTAATGAAAGACATGAATGTGTCTGGGTCAAGCCGGCAGCCGCCGAGGAAACCCACC
GAGGAGCCTGAGACTGTCAGTGAAGCCGAAGATGAAGAAGATGATATCATCAAGCGTGGATTGGCAGATGGAGAA
GACAGTGACTATGAGGACTACGTGGGGCCTAACGCTGGCAATGATGAGGGTCTTACTCAACGTTACCAGGAGGCT
CTGGCAGGCTCACAAAGTACTCCATCAGAGCAGGATAACAGCTTCACAAGATATCTGCGCGCAAGCAATATGCAA
CAGTGA
Gene >Pro_DTO377G3_2|g3575.t1
ATGGCATCTCCGGTGGCCGTGGTCTGCGTGGGCATGGCAGGTAAGGATGCTGATCGCCCCTCACCTATCTACAAC
GATCTAATCGTCAGTGTTATGGATTGAATAGGCTCAGGCAAGACGACCTTCATGCAAAGAATCAACTCCTATCTG
CATGAAAAGAAGACCGTGCCGTATGTGATCAATCTCGACCCCGCGGTGCATTCGGTACCCTTCGAGAGCAACATC
GATATCCGTGACTCCATTAATTACAAAGAAGTGATGAAGCAGTACAACCTGGGTCCTAACGGAGGAATTTTGACT
TCATTAAATCTGTTCGCCACCAAAGTCGATCAAATTATCTCGCTCCTAGAGAAACGCACCGCCCCGAACCCTGAA
AACCCTTCCGCAACACCAATCAAGCACATCTTGGTCGACACACCCGGCCAAATCGAAGTCTTTGTCTGGAGTGCA
TCGGGCAGTATCCTTCTCGAGACTATGGCGACATCATTCCCAACGGTCATCGCATATGTTATCGATACGCCTCGC
GCAAGCTCTACCAGCACCTTCATGAGCAACATGCTGTACGCATGTAGTATCTTGTACAAGACCAAGCTCCCCATG
ATCTTGGTCTTCAACAAGACTGACGTCAAGGATGCTGAGTTTGCCAAGGAATGGATGACCGACTTTGATGCATTC
CAGCAGGCTCTGCGGCAGGAGGAAGACGCGGGGGCCTTTGGAGCTGAGGGCGGTGCCGGTGGCTTTGGTTCTGGC
AGTGGATACATGGGCTCCCTTCTGAACAGCATGAGTCTCATGTTGGAAGAATTCTATCGACACCTCAGCGTCGTT
GGCGTCAGCTCAATGACGGGCGATGGTGTCGAGGAGTTCTTCGAGGCTGTGGAGACAAAGCGACAGGAGTTTGAA
CGTGACTACAAGCCCGAATTGGAGCGCAAGAAGAAAGAGCGCGAAGAGCAATCATCATCCCAGCGGGAGCTTGAA
CTTGGAAAATTAATGAAAGACATGAATGTGTCTGGGTCAAGCCGGCAGCCGCCGAGGAAACCCACCGAGGAGCCT
GAGACTGTCAGTGAAGCCGAAGATGAAGAAGATGATATCATCAAGCGTGGATTGGCAGATGGAGAAGACAGTGAC
TATGAGGACTACGTGGGGCCTAACGCTGGCAATGATGAGGGTCTTACTCAACGTTACCAGGAGGCTCTGGCAGGC
TCACAAAGTACTCCATCAGAGCAGGATAACAGCTTCACAAGATATCTGCGCGCAAGCAATATGCAACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail