Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3568.t1
Gene name
Locationscaffold_06:121542..123000
Strand-
Gene length (bp)1458
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 1.5E-20 133 238
PF13242 Hydrolase_like HAD-hyrolase-like 2.7E-20 365 451

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 793.79 430.34 1157.24
5d_25C Five days - 25 degrees Celsius 591.04 330.98 851.10
7d_25C Seven days - 25 degrees Celsius 511.36 290.35 732.37
10d_25C Ten days - 25 degrees Celsius 394.88 228.99 560.77
7d_15C Seven days - 15 degrees Celsius 855.23 461.11 1249.35
7d_30C Seven days - 30 degrees Celsius 303.90 175.57 432.24

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.275260 no
3d_25C 7d_25C 0.074872 no
3d_25C 7d_15C 0.839142 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.002297 yes
5d_25C 7d_25C 0.631550 no
5d_25C 7d_15C 0.151283 no
5d_25C 7d_30C 0.004840 yes
5d_25C 10d_25C 0.089629 no
7d_25C 7d_15C 0.030233 yes
7d_25C 7d_30C 0.017762 yes
7d_25C 10d_25C 0.312643 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.301800 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3568.t1
MSRVEDSDLAVDLAEQDPRAQDPQGALSPRDQRASSGLAIPSAGGNTVEIPATRSAISDAAQFMHNLSLSPSMRD
RRGSRNSFGTSLPIPRSPRMSRLSSVQRGAPSVSRDILASQVQDINKELTTKAKNMAFAFDIDGVLAHGNHAIDE
AKVVLKILNGDNELGIRIPHILLTNGGGKTEEARCAQLTEILEQPISTDQFIQSHTPMQALAEYYQTVLVLGGEG
FKIREVAENYGFKTVVHPKDLLAWDPSISPWATLTEAEKAEAKPRDFSKMKFDAIMVFADSRDYQTDIQVIMDLL
LAEDGMIGTKAKDPVATRIPIYFSQGDLLMPTEHKGLPRLTQGAFRIAIEAQYKTLTGVDLERVVYGKPERATYT
YADEVLKAWMEELHGVSRLPDNVYMIGDNPASDIIGGNMYGWNTCLVRTGVFQGKEGENDPNSPANFGVFNNVLE
AVKAALAKELGPDFKLKWNPKVNPVTHGDGASAIE*
Coding >Pro_DTO377G3_2|g3568.t1
ATGTCTCGCGTCGAGGACTCTGACCTCGCAGTCGACCTGGCTGAGCAGGATCCCCGCGCCCAGGATCCTCAGGGT
GCTCTCTCCCCTCGGGACCAGCGTGCTAGCTCCGGTCTCGCCATCCCATCGGCAGGCGGTAACACCGTCGAGATC
CCCGCCACCCGCAGCGCCATCAGTGATGCCGCTCAATTCATGCACAACTTGAGCTTGTCTCCCTCCATGAGGGAC
CGCCGGGGATCGCGTAACTCCTTTGGCACTTCGCTCCCTATCCCCCGCTCCCCCCGCATGTCCCGCCTCTCGTCC
GTGCAGCGCGGTGCTCCCTCAGTCTCCCGCGATATCTTGGCCTCTCAGGTTCAGGATATCAACAAGGAGCTGACT
ACCAAGGCGAAGAACATGGCCTTTGCTTTCGATATTGATGGTGTGCTGGCACACGGTAACCACGCCATTGACGAG
GCCAAGGTCGTCCTCAAGATCCTCAACGGCGACAACGAGTTGGGCATCCGCATCCCCCACATTCTCCTCACCAAC
GGTGGTGGTAAGACCGAGGAGGCTCGCTGTGCTCAGCTTACCGAGATTCTCGAGCAGCCCATCTCCACCGACCAG
TTCATTCAATCCCACACTCCCATGCAGGCCCTGGCAGAGTACTACCAGACCGTTCTGGTCCTCGGTGGTGAAGGC
TTTAAGATCCGCGAGGTTGCCGAAAACTACGGCTTCAAGACTGTCGTGCACCCCAAGGATCTCCTCGCCTGGGAC
CCCTCCATCTCCCCCTGGGCTACTCTCACCGAAGCAGAGAAGGCCGAGGCCAAGCCCCGCGACTTCTCCAAGATG
AAGTTCGATGCCATCATGGTCTTCGCTGATTCCCGTGACTACCAGACCGATATCCAGGTCATTATGGATCTGCTG
CTCGCCGAGGACGGCATGATCGGCACCAAGGCCAAGGATCCCGTCGCCACCCGCATTCCTATCTACTTCTCCCAG
GGTGATCTCCTCATGCCCACCGAGCACAAGGGTCTTCCCCGTCTCACCCAGGGTGCCTTCCGTATCGCCATTGAG
GCTCAGTACAAGACACTCACCGGTGTCGACCTCGAGCGTGTTGTCTACGGTAAGCCCGAGCGTGCTACCTACACC
TACGCCGACGAGGTCCTGAAGGCCTGGATGGAGGAGCTCCACGGTGTTTCCCGTCTGCCCGATAACGTCTACATG
ATCGGTGACAACCCCGCTTCCGATATCATCGGTGGAAACATGTATGGCTGGAACACTTGCTTGGTCCGCACTGGT
GTCTTCCAGGGCAAGGAGGGCGAGAATGACCCCAACAGCCCTGCCAACTTCGGTGTCTTCAACAATGTCCTCGAA
GCCGTCAAGGCTGCCCTCGCCAAGGAGCTCGGCCCCGACTTCAAGCTCAAGTGGAACCCCAAGGTCAACCCCGTC
ACTCACGGCGACGGTGCCTCCGCCATTGAGTAA
Transcript >Pro_DTO377G3_2|g3568.t1
ATGTCTCGCGTCGAGGACTCTGACCTCGCAGTCGACCTGGCTGAGCAGGATCCCCGCGCCCAGGATCCTCAGGGT
GCTCTCTCCCCTCGGGACCAGCGTGCTAGCTCCGGTCTCGCCATCCCATCGGCAGGCGGTAACACCGTCGAGATC
CCCGCCACCCGCAGCGCCATCAGTGATGCCGCTCAATTCATGCACAACTTGAGCTTGTCTCCCTCCATGAGGGAC
CGCCGGGGATCGCGTAACTCCTTTGGCACTTCGCTCCCTATCCCCCGCTCCCCCCGCATGTCCCGCCTCTCGTCC
GTGCAGCGCGGTGCTCCCTCAGTCTCCCGCGATATCTTGGCCTCTCAGGTTCAGGATATCAACAAGGAGCTGACT
ACCAAGGCGAAGAACATGGCCTTTGCTTTCGATATTGATGGTGTGCTGGCACACGGTAACCACGCCATTGACGAG
GCCAAGGTCGTCCTCAAGATCCTCAACGGCGACAACGAGTTGGGCATCCGCATCCCCCACATTCTCCTCACCAAC
GGTGGTGGTAAGACCGAGGAGGCTCGCTGTGCTCAGCTTACCGAGATTCTCGAGCAGCCCATCTCCACCGACCAG
TTCATTCAATCCCACACTCCCATGCAGGCCCTGGCAGAGTACTACCAGACCGTTCTGGTCCTCGGTGGTGAAGGC
TTTAAGATCCGCGAGGTTGCCGAAAACTACGGCTTCAAGACTGTCGTGCACCCCAAGGATCTCCTCGCCTGGGAC
CCCTCCATCTCCCCCTGGGCTACTCTCACCGAAGCAGAGAAGGCCGAGGCCAAGCCCCGCGACTTCTCCAAGATG
AAGTTCGATGCCATCATGGTCTTCGCTGATTCCCGTGACTACCAGACCGATATCCAGGTCATTATGGATCTGCTG
CTCGCCGAGGACGGCATGATCGGCACCAAGGCCAAGGATCCCGTCGCCACCCGCATTCCTATCTACTTCTCCCAG
GGTGATCTCCTCATGCCCACCGAGCACAAGGGTCTTCCCCGTCTCACCCAGGGTGCCTTCCGTATCGCCATTGAG
GCTCAGTACAAGACACTCACCGGTGTCGACCTCGAGCGTGTTGTCTACGGTAAGCCCGAGCGTGCTACCTACACC
TACGCCGACGAGGTCCTGAAGGCCTGGATGGAGGAGCTCCACGGTGTTTCCCGTCTGCCCGATAACGTCTACATG
ATCGGTGACAACCCCGCTTCCGATATCATCGGTGGAAACATGTATGGCTGGAACACTTGCTTGGTCCGCACTGGT
GTCTTCCAGGGCAAGGAGGGCGAGAATGACCCCAACAGCCCTGCCAACTTCGGTGTCTTCAACAATGTCCTCGAA
GCCGTCAAGGCTGCCCTCGCCAAGGAGCTCGGCCCCGACTTCAAGCTCAAGTGGAACCCCAAGGTCAACCCCGTC
ACTCACGGCGACGGTGCCTCCGCCATTGAGTAA
Gene >Pro_DTO377G3_2|g3568.t1
ATGTCTCGCGTCGAGGACTCTGACCTCGCAGTCGACCTGGCTGAGCAGGATCCCCGCGCCCAGGATCCTCAGGGT
GCTCTCTCCCCTCGGGACCAGCGTGCTAGCTCCGGTCTCGCCATCCCATCGGCAGGCGGTAACACCGTCGAGATC
CCCGCCACCCGCAGCGCCATCAGTGATGCCGCTCAATTCATGCACAACTTGAGCTTGTCTCCCTCCATGAGGGAC
CGCCGGGGATCGCGTAACTCCTTTGGCACTTCGCTCCCTATCCCCCGCTCCCCCCGCATGTCCCGCCTCTCGTCC
GTGCAGCGCGGTGCTCCCTCAGTCTCCCGCGATATCTTGGCCTCTCAGGTTCAGGATATCAACAAGGAGCTGACT
ACCAAGGCGAAGAACATGGCCTTTGCTTTCGATATTGATGGTGTGCTGGCACACGGTAACCACGCCATTGACGAG
GCCAAGGTCGTCCTCAAGATCCTCAACGGCGACAACGAGTTGGGCATCCGCATCCCCCACATTCTCCTCACCAAC
GGTGGTGGTAAGACCGAGGAGGCTCGCTGTGCTCAGCTTACCGAGATTCTCGAGCAGCCCATCTCCACCGACCAG
TTCATTCAATCCCACACTCCCATGCAGGCCCTGGCAGAGTACTACCAGACCGTTCTGGTCCTCGGTGGTGAAGGC
TTTAAGATCCGCGAGGTTGCCGAAAACTACGGCTTCAAGACTGTCGTGCACCCCAAGGATCTCCTCGCCTGGGAC
CCCTCCATCTCCCCCTGGGCTACTCTCACCGAAGCAGAGAAGGCCGAGGCCAAGCCCCGCGACTTCTCCAAGATG
AAGTTCGATGCCATCATGGTCTTCGCTGATTCCCGTGACTACCAGACCGATATCCAGGTCATTATGGATCTGCTG
CTCGCCGAGGACGGCATGATCGGCACCAAGGCCAAGGATCCCGTCGCCACCCGCATTCCTATCTACTTCTCCCAG
GGTGATCTCCTCATGCCCACCGAGCACAAGGGTCTTCCCCGTCTCACCCAGGGTGCCTTCCGTATCGCCATTGAG
GCTCAGTACAAGACACTCACCGGTGTCGACCTCGAGCGTGTTGTCTACGGTAAGCCCGAGCGTGCTACCTACACC
TACGCCGACGAGGTCCTGAAGGCCTGGATGGAGGAGCTCCACGGTGTTTCCCGTCTGCCCGATAACGTCTACATG
ATCGGTGACAACCCCGCTTCCGATATCATCGGTGGAAACATGTATGGCTGGAACACTTGCTTGGTCCGCACTGGT
GTCTTCCAGGGCAAGGAGGGCGAGAATGACCCCAACAGCCCTGCCAACTTCGGTGTCTTCAACAATGTCCTCGAA
GCCGTCAAGGCTGCCCTCGCCAAGGAGCTCGGCCCCGACTTCAAGCTCAAGTGGAACCCCAAGGTCAACCCCGTC
ACTCACGGCGACGGTGCCTCCGCCATTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail