Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3561.t1
Gene name
Locationscaffold_06:103014..106359
Strand+
Gene length (bp)3345
Transcript length (bp)3174
Coding sequence length (bp)3174
Protein length (aa) 1058

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02779 Transket_pyr Transketolase, pyrimidine binding domain 2.1E-65 682 894
PF00676 E1_dh Dehydrogenase E1 component 4.7E-58 292 607
PF16870 OxoGdeHyase_C 2-oxoglutarate dehydrogenase C-terminal 1.1E-57 897 1047
PF16078 2-oxogl_dehyd_N 2-oxoglutarate dehydrogenase N-terminus 6.6E-20 78 117

GO

GO Term Description Terminal node
GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor Yes
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3561.t1
MFRNSALKATNSGMLRGATSSSCRRSFHLATAARNTSKSSGFSLAARRPMAVVDRAFNGSRSYAASSEGPSQGVD
PNDSFLTGSTANYIDEMYLAWKNDPSSVHISWQAYFKNMEEGKMPISQAFTPPPTLVPTPTGGVPQEMPGLGLHA
GADVTNHLKVQLLCRAYQARGHHKAKIDPLGIRGEAEAFGYDKPKELELDHYGFTERDLDQEFSLGPGILPRFIT
ETRKTMTLREIIATCEKIYCGSYGVEYIHIPDRKPCEWIRDRFEVPQPYSYSVDDKRRILDRLIWSSSFETFLAT
KFPNDKRFGLEGCETLVPGMKALIDRSVDYGIKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFSGSTEPSDEGSG
DVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNKDESHFDTAMGVLLHGDAAFAGQGVV
YETMGMHSLPAYSTGGTIHLIVNNQIGFTTDPRYSRSTPYCSDIAKSIDAPVFHVNADDVEAVNYICQVAADWRA
EFKSDVVIDMVCYRKQGHNETDQPSFTQPLMYKRIAAQKPQLDKYVDKLIAEGTFTKEDIDEHKKWVWGMLADSF
DRSDDYQPTGKEWLTSAWNNFKSPKELANEVLPHLPTAVPAKNLQHIGDLISGDGVPKGFVLHHNLKRILGGRKK
AVDQGKNIDWATAEALAFGSLVEEGYHVRVSGQDVERGTFSQRHAVLHDQETESTYTPLHHVSENQGSFVISNSS
LSEYGCLGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQFIASGESKWLQRSGLVVSLPHGYDGQGPEHSSGR
MERWLQLCNEEPRVFPSADKLDRQHQDCNMQIACMTSPANLFHILRRQIHRQFRKPLVIFFSKSLLRHPLARSDI
EALEGESHFQWIIPDDAAAIDAPEKIERVILCSGQVYAALIKHREANKITNTAITRVEQLHPFPWAQLKENLDSY
PNAKNIVWCQEEPLNAGSWSYTQPRLETLLNSTEHHHRRHVLYAGRAPSASVATGLKAVHLKEEQEFLEDAFSIE
QDHLKNE*
Coding >Pro_DTO377G3_2|g3561.t1
ATGTTCAGAAACAGTGCCTTGAAGGCCACCAACAGCGGCATGCTGCGTGGTGCGACCTCTTCATCATGCCGGCGT
TCATTCCACCTCGCCACAGCTGCTCGCAATACGTCAAAAAGCTCCGGCTTCAGCCTGGCCGCCCGTCGGCCTATG
GCTGTTGTCGACCGTGCTTTCAACGGTTCCCGGTCCTATGCGGCCTCCTCGGAGGGACCTAGTCAAGGAGTGGAC
CCCAACGATTCTTTCCTTACTGGCAGCACTGCCAATTACATCGATGAGATGTACTTGGCATGGAAGAACGACCCC
TCGAGTGTTCACATCTCATGGCAGGCGTACTTCAAGAACATGGAAGAGGGCAAAATGCCTATCTCCCAGGCCTTC
ACTCCTCCCCCTACCCTTGTCCCCACCCCTACCGGTGGTGTTCCCCAGGAAATGCCCGGCCTGGGCCTCCACGCT
GGCGCTGACGTCACCAACCACTTGAAGGTCCAGTTGCTCTGCCGCGCCTACCAGGCGCGTGGTCACCACAAGGCC
AAGATCGACCCTCTCGGCATTCGCGGAGAGGCCGAGGCCTTTGGCTACGACAAGCCCAAGGAGCTTGAGTTGGAC
CACTACGGCTTCACTGAGCGTGATTTGGACCAGGAGTTTTCCCTTGGACCCGGTATCTTGCCCCGTTTCATCACC
GAAACCCGCAAGACCATGACTCTGCGCGAGATCATCGCCACCTGCGAGAAGATCTACTGTGGCTCTTACGGTGTC
GAGTACATTCACATTCCCGACCGCAAGCCCTGCGAGTGGATCCGTGATCGTTTCGAGGTCCCCCAGCCTTACAGC
TACTCGGTTGACGACAAGCGTCGCATCCTTGACCGTCTGATCTGGTCTTCCAGCTTCGAGACATTCCTCGCTACC
AAGTTCCCCAACGACAAGCGTTTCGGTCTGGAGGGTTGCGAGACCCTGGTTCCCGGTATGAAGGCCTTGATCGAT
CGCAGCGTCGATTACGGTATCAAGGACATCGTCATTGGTATGCCTCACCGTGGTCGTCTTAACGTTTTGTCCAAC
GTCGTCCGCAAGCCCAACGAGTCCATCTTCAGCGAGTTCTCCGGCTCTACTGAGCCTTCTGATGAGGGCTCCGGT
GATGTCAAGTACCACTTGGGTATGAACTTTGAGCGCCCTACTCCCTCCGGTAAGCGAGTGCAGCTGTCTCTGGTT
GCCAACCCCTCTCACCTCGAGGCTGAGGACCCTGTTGTTCTTGGAAAGACCCGTGCTATCCAGCACTACAACAAG
GACGAGTCTCACTTCGACACCGCCATGGGTGTTCTGCTGCACGGTGACGCTGCCTTTGCTGGCCAAGGTGTTGTC
TACGAGACCATGGGAATGCACTCTCTCCCTGCCTACTCCACCGGTGGTACCATCCACCTTATCGTGAACAATCAG
ATTGGTTTCACCACCGATCCCCGTTACTCCCGGTCCACCCCCTACTGTTCCGATATTGCCAAGTCCATCGACGCC
CCTGTCTTCCACGTGAACGCAGACGATGTTGAGGCTGTCAACTACATCTGCCAGGTCGCTGCCGACTGGCGCGCT
GAGTTCAAGAGTGATGTTGTCATTGACATGGTCTGCTACCGTAAGCAGGGTCACAACGAGACTGATCAGCCTTCG
TTCACCCAGCCCCTTATGTACAAGCGCATTGCCGCCCAGAAGCCTCAGCTCGACAAGTACGTCGATAAGCTGATT
GCCGAGGGTACCTTCACCAAGGAGGACATTGATGAACACAAGAAGTGGGTCTGGGGAATGCTCGCCGACAGCTTC
GATCGCAGCGATGACTACCAGCCCACTGGTAAGGAGTGGCTGACCTCCGCTTGGAACAACTTCAAGTCTCCCAAG
GAGCTGGCCAATGAGGTCCTGCCTCACCTGCCTACCGCTGTTCCTGCCAAGAACCTACAGCACATTGGTGACCTG
ATCTCTGGTGACGGTGTTCCCAAGGGCTTCGTGCTCCACCACAATCTCAAGCGTATTTTGGGTGGACGCAAGAAG
GCCGTTGACCAGGGCAAGAACATCGATTGGGCCACTGCTGAGGCTCTCGCTTTCGGTTCCCTCGTTGAGGAAGGC
TACCACGTCCGTGTCTCCGGTCAGGATGTTGAGCGTGGTACTTTCTCCCAGCGCCACGCAGTCCTGCACGACCAG
GAGACTGAGAGCACTTACACCCCCCTTCACCACGTCAGTGAGAACCAGGGAAGCTTCGTCATCTCTAACTCCTCC
CTGAGCGAATACGGTTGTCTCGGCTTCGAGTACGGTTACTCTTTGACCTCCCCCAACGCCCTTGTGATGTGGGAG
GCTCAGTTCGGTGATTTCGCCAACAACGCTCAGTGTATCATTGATCAGTTCATCGCCTCTGGTGAATCCAAGTGG
CTGCAGCGTTCCGGCCTGGTTGTGTCTCTGCCTCACGGTTATGACGGCCAGGGCCCCGAGCACTCTTCCGGACGT
ATGGAGCGCTGGCTCCAGCTTTGCAACGAGGAGCCCCGTGTGTTCCCCTCGGCCGACAAGCTGGACCGTCAGCAC
CAGGACTGCAATATGCAGATCGCCTGCATGACCAGCCCTGCCAACCTGTTCCACATCCTCCGTCGCCAAATCCAC
CGCCAGTTCCGCAAGCCTCTGGTCATCTTCTTCTCCAAGTCTCTGCTGCGTCACCCCCTTGCCCGCTCTGACATC
GAGGCCCTGGAAGGCGAGTCCCACTTCCAGTGGATCATCCCCGATGACGCCGCCGCCATCGACGCCCCCGAGAAG
ATCGAGCGTGTTATCCTGTGCTCTGGACAGGTCTACGCTGCCTTGATCAAGCACCGCGAGGCCAACAAGATCACC
AACACTGCCATCACCCGTGTTGAGCAGCTGCACCCCTTCCCTTGGGCTCAGCTGAAGGAGAACTTGGACAGCTAC
CCCAACGCTAAGAACATCGTCTGGTGCCAGGAGGAGCCTCTCAACGCCGGTTCCTGGTCATACACCCAGCCCCGT
CTTGAAACCCTGCTCAACTCTACCGAGCACCACCACCGCCGCCATGTCCTGTACGCCGGTCGCGCTCCTAGCGCT
TCCGTTGCCACCGGTCTCAAGGCCGTCCACCTCAAGGAGGAGCAGGAGTTCCTTGAGGATGCTTTCTCTATTGAA
CAGGATCACCTGAAGAACGAGTAA
Transcript >Pro_DTO377G3_2|g3561.t1
ATGTTCAGAAACAGTGCCTTGAAGGCCACCAACAGCGGCATGCTGCGTGGTGCGACCTCTTCATCATGCCGGCGT
TCATTCCACCTCGCCACAGCTGCTCGCAATACGTCAAAAAGCTCCGGCTTCAGCCTGGCCGCCCGTCGGCCTATG
GCTGTTGTCGACCGTGCTTTCAACGGTTCCCGGTCCTATGCGGCCTCCTCGGAGGGACCTAGTCAAGGAGTGGAC
CCCAACGATTCTTTCCTTACTGGCAGCACTGCCAATTACATCGATGAGATGTACTTGGCATGGAAGAACGACCCC
TCGAGTGTTCACATCTCATGGCAGGCGTACTTCAAGAACATGGAAGAGGGCAAAATGCCTATCTCCCAGGCCTTC
ACTCCTCCCCCTACCCTTGTCCCCACCCCTACCGGTGGTGTTCCCCAGGAAATGCCCGGCCTGGGCCTCCACGCT
GGCGCTGACGTCACCAACCACTTGAAGGTCCAGTTGCTCTGCCGCGCCTACCAGGCGCGTGGTCACCACAAGGCC
AAGATCGACCCTCTCGGCATTCGCGGAGAGGCCGAGGCCTTTGGCTACGACAAGCCCAAGGAGCTTGAGTTGGAC
CACTACGGCTTCACTGAGCGTGATTTGGACCAGGAGTTTTCCCTTGGACCCGGTATCTTGCCCCGTTTCATCACC
GAAACCCGCAAGACCATGACTCTGCGCGAGATCATCGCCACCTGCGAGAAGATCTACTGTGGCTCTTACGGTGTC
GAGTACATTCACATTCCCGACCGCAAGCCCTGCGAGTGGATCCGTGATCGTTTCGAGGTCCCCCAGCCTTACAGC
TACTCGGTTGACGACAAGCGTCGCATCCTTGACCGTCTGATCTGGTCTTCCAGCTTCGAGACATTCCTCGCTACC
AAGTTCCCCAACGACAAGCGTTTCGGTCTGGAGGGTTGCGAGACCCTGGTTCCCGGTATGAAGGCCTTGATCGAT
CGCAGCGTCGATTACGGTATCAAGGACATCGTCATTGGTATGCCTCACCGTGGTCGTCTTAACGTTTTGTCCAAC
GTCGTCCGCAAGCCCAACGAGTCCATCTTCAGCGAGTTCTCCGGCTCTACTGAGCCTTCTGATGAGGGCTCCGGT
GATGTCAAGTACCACTTGGGTATGAACTTTGAGCGCCCTACTCCCTCCGGTAAGCGAGTGCAGCTGTCTCTGGTT
GCCAACCCCTCTCACCTCGAGGCTGAGGACCCTGTTGTTCTTGGAAAGACCCGTGCTATCCAGCACTACAACAAG
GACGAGTCTCACTTCGACACCGCCATGGGTGTTCTGCTGCACGGTGACGCTGCCTTTGCTGGCCAAGGTGTTGTC
TACGAGACCATGGGAATGCACTCTCTCCCTGCCTACTCCACCGGTGGTACCATCCACCTTATCGTGAACAATCAG
ATTGGTTTCACCACCGATCCCCGTTACTCCCGGTCCACCCCCTACTGTTCCGATATTGCCAAGTCCATCGACGCC
CCTGTCTTCCACGTGAACGCAGACGATGTTGAGGCTGTCAACTACATCTGCCAGGTCGCTGCCGACTGGCGCGCT
GAGTTCAAGAGTGATGTTGTCATTGACATGGTCTGCTACCGTAAGCAGGGTCACAACGAGACTGATCAGCCTTCG
TTCACCCAGCCCCTTATGTACAAGCGCATTGCCGCCCAGAAGCCTCAGCTCGACAAGTACGTCGATAAGCTGATT
GCCGAGGGTACCTTCACCAAGGAGGACATTGATGAACACAAGAAGTGGGTCTGGGGAATGCTCGCCGACAGCTTC
GATCGCAGCGATGACTACCAGCCCACTGGTAAGGAGTGGCTGACCTCCGCTTGGAACAACTTCAAGTCTCCCAAG
GAGCTGGCCAATGAGGTCCTGCCTCACCTGCCTACCGCTGTTCCTGCCAAGAACCTACAGCACATTGGTGACCTG
ATCTCTGGTGACGGTGTTCCCAAGGGCTTCGTGCTCCACCACAATCTCAAGCGTATTTTGGGTGGACGCAAGAAG
GCCGTTGACCAGGGCAAGAACATCGATTGGGCCACTGCTGAGGCTCTCGCTTTCGGTTCCCTCGTTGAGGAAGGC
TACCACGTCCGTGTCTCCGGTCAGGATGTTGAGCGTGGTACTTTCTCCCAGCGCCACGCAGTCCTGCACGACCAG
GAGACTGAGAGCACTTACACCCCCCTTCACCACGTCAGTGAGAACCAGGGAAGCTTCGTCATCTCTAACTCCTCC
CTGAGCGAATACGGTTGTCTCGGCTTCGAGTACGGTTACTCTTTGACCTCCCCCAACGCCCTTGTGATGTGGGAG
GCTCAGTTCGGTGATTTCGCCAACAACGCTCAGTGTATCATTGATCAGTTCATCGCCTCTGGTGAATCCAAGTGG
CTGCAGCGTTCCGGCCTGGTTGTGTCTCTGCCTCACGGTTATGACGGCCAGGGCCCCGAGCACTCTTCCGGACGT
ATGGAGCGCTGGCTCCAGCTTTGCAACGAGGAGCCCCGTGTGTTCCCCTCGGCCGACAAGCTGGACCGTCAGCAC
CAGGACTGCAATATGCAGATCGCCTGCATGACCAGCCCTGCCAACCTGTTCCACATCCTCCGTCGCCAAATCCAC
CGCCAGTTCCGCAAGCCTCTGGTCATCTTCTTCTCCAAGTCTCTGCTGCGTCACCCCCTTGCCCGCTCTGACATC
GAGGCCCTGGAAGGCGAGTCCCACTTCCAGTGGATCATCCCCGATGACGCCGCCGCCATCGACGCCCCCGAGAAG
ATCGAGCGTGTTATCCTGTGCTCTGGACAGGTCTACGCTGCCTTGATCAAGCACCGCGAGGCCAACAAGATCACC
AACACTGCCATCACCCGTGTTGAGCAGCTGCACCCCTTCCCTTGGGCTCAGCTGAAGGAGAACTTGGACAGCTAC
CCCAACGCTAAGAACATCGTCTGGTGCCAGGAGGAGCCTCTCAACGCCGGTTCCTGGTCATACACCCAGCCCCGT
CTTGAAACCCTGCTCAACTCTACCGAGCACCACCACCGCCGCCATGTCCTGTACGCCGGTCGCGCTCCTAGCGCT
TCCGTTGCCACCGGTCTCAAGGCCGTCCACCTCAAGGAGGAGCAGGAGTTCCTTGAGGATGCTTTCTCTATTGAA
CAGGATCACCTGAAGAACGAGTAA
Gene >Pro_DTO377G3_2|g3561.t1
ATGTTCAGAAACAGTGCCTTGAAGGCCACCAACAGCGGCATGCTGCGTGGTGCGACCTCTTCATCATGCCGGCGT
TCATTCCACCTCGCCACAGCTGCTCGCAATACGTCAAAAAGCTCCGGCTTCAGCCTGGCCGCCCGTCGGCCTATG
GCTGTTGTCGACCGTGCTTTCAACGGTTCCCGGTCCTATGCGGCCTCCTCGGAGGGACCTAGTCAAGGAGTGGTA
AGCAACAACAATCCTCATGATCGGTGTCAATCCGATCCGGTTTCCCCGGTAGTTCAAATATATCAACGGGCATTC
GACTAATGCGACGGCGCGATCGCTCTTACGTGAACAGGACCCCAACGATTCTTTCCTTACTGGCAGCACTGCCAA
TTACATCGATGAGATGTACTTGGCATGGAAGAACGACCCCTCGAGTGTTCACATCTCATGGCAGGCGTACTTCAA
GAACATGGAAGAGGGCAAAATGCCTATCTCCCAGGCCTTCACTCCTCCCCCTACCCTTGTCCCCACCCCTACCGG
TGGTGTTCCCCAGGAAATGCCCGGCCTGGGCCTCCACGCTGGCGCTGACGTCACCAACCACTTGAAGGTCCAGTT
GCTCTGCCGCGCCTACCAGGCGCGTGGTCACCACAAGGCCAAGATCGACCCTCTCGGCATTCGCGGAGAGGCCGA
GGCCTTTGGCTACGACAAGCCCAAGGAGCTTGAGTTGGACCACTACGGCTTCACTGAGCGTGATTTGGACCAGGA
GTTTTCCCTTGGACCCGGTATCTTGCCCCGTTTCATCACCGAAACCCGCAAGACCATGACTCTGCGCGAGATCAT
CGCCACCTGCGAGAAGATCTACTGTGGCTCTTACGGTGTCGAGTACATTCACATTCCCGACCGCAAGCCCTGCGA
GTGGATCCGTGATCGTTTCGAGGTCCCCCAGCCTTACAGCTACTCGGTTGACGACAAGCGTCGCATCCTTGACCG
TCTGATCTGGTCTTCCAGCTTCGAGACATTCCTCGCTACCAAGTTCCCCAACGACAAGCGTTTCGGTCTGGAGGG
TTGCGAGACCCTGGTTCCCGGTATGAAGGCCTTGATCGATCGCAGCGTCGATTACGGTATCAAGGACATCGTCAT
TGGTATGCCTCACCGTGGTCGTCTTAACGTTTTGTCCAACGTCGTCCGCAAGCCCAACGAGTCCATCTTCAGCGA
GTTCTCCGGCTCTACTGAGCCTTCTGATGAGGGCTCCGGTGATGTCAAGTACCACTTGGGTATGAACTTTGAGCG
CCCTACTCCCTCCGGTAAGCGAGTGCAGCTGTCTCTGGTTGCCAACCCCTCTCACCTCGAGGCTGAGGACCCTGT
TGTTCTTGGAAAGACCCGTGCTATCCAGCACTACAACAAGGACGAGTCTCACTTCGACACCGCCATGGGTGTTCT
GCTGCACGGTGACGCTGCCTTTGCTGGCCAAGGTGTTGTCTACGAGACCATGGGAATGCACTCTCTCCCTGCCTA
CTCCACCGGTGGTACCATCCACCTTATCGTGAACAATCAGATTGGTTTCACCACCGATCCCCGTTACTCCCGGTC
CACCCCCTACTGTTCCGATATTGCCAAGTCCATCGACGCCCCTGTCTTCCACGTGAACGCAGACGATGTTGAGGC
TGTCAACTACATCTGCCAGGTCGCTGCCGACTGGCGCGCTGAGTTCAAGAGTGATGTTGTCATTGACATGGTCTG
CTACCGTAAGCAGGGTCACAACGAGACTGATCAGCCTTCGTTCACCCAGCCCCTTATGTACAAGCGCATTGCCGC
CCAGAAGCCTCAGCTCGACAAGTACGTCGATAAGCTGATTGCCGAGGGTACCTTCACCAAGGAGGACATTGATGA
ACACAAGAAGTGGGTCTGGGGAATGCTCGCCGACAGCTTCGATCGCAGCGATGACTACCAGCCCACTGGTAAGGA
GTGGCTGACCTCCGCTTGGAACAACTTCAAGTCTCCCAAGGAGCTGGCCAATGAGGTCCTGCCTCACCTGCCTAC
CGCTGTTCCTGCCAAGAACCTACAGCACATTGGTGACCTGATCTCTGGTGACGGTGTTCCCAAGGGCTTCGTGCT
CCACCACAATCTCAAGCGTATTTTGGGTGGACGCAAGAAGGCCGTTGACCAGGGCAAGAACATCGATTGGGCCAC
TGCTGAGGCTCTCGCTTTCGGTTCCCTCGTTGAGGAAGGCTACCACGTCCGTGTCTCCGGTCAGGATGTTGAGCG
TGGTACTTTCTCCCAGCGCCACGCAGTCCTGCACGACCAGGAGACTGAGAGCACTTACACCCCCCTTCACCACGT
CAGTGAGAACCAGGGAAGCTTCGTCATCTCTAACTCCTCCCTGAGCGAATACGGTTGGTAGGTTTTTGAAGTCGA
CTTCCCCCGCGTAATAATAATTCTAACATGCAATCTAGTCTCGGCTTCGAGTACGGTTACTCTTTGACCTCCCCC
AACGCCCTTGTGATGTGGGAGGCTCAGTTCGGTGATTTCGCCAACAACGCTCAGTGTATCATTGATCAGTTCATC
GCCTCTGGTGAATCCAAGTGGCTGCAGCGTTCCGGCCTGGTTGTGTCTCTGCCTCACGGTTATGACGGCCAGGGC
CCCGAGCACTCTTCCGGACGTATGGAGCGCTGGCTCCAGCTTTGCAACGAGGAGCCCCGTGTGTTCCCCTCGGCC
GACAAGCTGGACCGTCAGCACCAGGACTGCAATATGCAGATCGCCTGCATGACCAGCCCTGCCAACCTGTTCCAC
ATCCTCCGTCGCCAAATCCACCGCCAGTTCCGCAAGCCTCTGGTCATCTTCTTCTCCAAGTCTCTGCTGCGTCAC
CCCCTTGCCCGCTCTGACATCGAGGCCCTGGAAGGCGAGTCCCACTTCCAGTGGATCATCCCCGATGACGCCGCC
GCCATCGACGCCCCCGAGAAGATCGAGCGTGTTATCCTGTGCTCTGGACAGGTCTACGCTGCCTTGATCAAGCAC
CGCGAGGCCAACAAGATCACCAACACTGCCATCACCCGTGTTGAGCAGCTGCACCCCTTCCCTTGGGCTCAGCTG
AAGGAGAACTTGGACAGCTACCCCAACGCTAAGAACATCGTCTGGTGCCAGGAGGAGCCTCTCAACGCCGGTTCC
TGGTCATACACCCAGCCCCGTCTTGAAACCCTGCTCAACTCTACCGAGCACCACCACCGCCGCCATGTCCTGTAC
GCCGGTCGCGCTCCTAGCGCTTCCGTTGCCACCGGTCTCAAGGCCGTCCACCTCAAGGAGGAGCAGGAGTTCCTT
GAGGATGCTTTCTCTATTGAACAGGATCACCTGAAGAACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail