Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3556.t1
Gene name
Locationscaffold_06:88123..89676
Strand-
Gene length (bp)1553
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00230 MIP Major intrinsic protein 2.7E-44 158 400

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015267 channel activity Yes
GO:0008150 biological_process No
GO:0022803 passive transmembrane transporter activity No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 164 186 22
2 196 218 22
3 239 261 22
4 295 317 22
5 330 352 22
6 377 399 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 88.83 54.36 123.30
5d_25C Five days - 25 degrees Celsius 104.16 63.58 144.74
7d_25C Seven days - 25 degrees Celsius 155.46 93.86 217.05
10d_25C Ten days - 25 degrees Celsius 177.66 107.33 247.98
7d_15C Seven days - 15 degrees Celsius 265.73 148.68 382.79
7d_30C Seven days - 30 degrees Celsius 44.73 24.81 64.66

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.541577 no
3d_25C 7d_25C 0.006742 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.001278 yes
5d_25C 7d_25C 0.052958 no
5d_25C 7d_15C 0.000700 yes
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.007437 yes
7d_25C 7d_15C 0.013513 yes
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.627258 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.080312 no
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3556.t1
MGNSREPGRDGGVKDAVDAPEYEQPEGTEEEASKNEGMGKNPSYSLAGSGAQNPNNNQGYTDEEYQKYASQYNKQ
DDGPTWSLAHPLPHIVRPGMRHGALPEDRKEDRKEDRDGTTENQQDSAHEEEVRKQQSSENRTKKVNDPKEDGFF
NTWSKIRHQLREPLAEWLGTTMAMTIGLCATLSNFTSSGQAGSYPAQSLAWGFGFMVAIYTTGGMSGGHLNPAIS
ISLSVFRGFPARRCVIYIAAQLLGAITAGGISYAIYHDAIVEVARLANVPQNASVASQALLTLPKPFVRPATAFF
TEFVGSAILLGSILALGDDTNAPPGAGMQAFIIGIIISIVILALGYNTGGCFNGARDFGPRLVALMAGWGGNIFR
EYHAWWVWGPWIADITGGLFGALIYDMAIFTGGESPVNYPPRRRKRAYRVRALNFRKKLRIGRKKLPDLERSVAA
TEQ*
Coding >Pro_DTO377G3_2|g3556.t1
ATGGGAAACTCGAGGGAACCTGGCCGGGATGGCGGAGTCAAGGATGCTGTGGATGCTCCCGAATATGAGCAACCA
GAAGGCACCGAAGAAGAAGCAAGCAAGAATGAAGGCATGGGCAAAAACCCATCATATAGTTTGGCTGGCTCTGGC
GCACAGAATCCAAACAACAACCAAGGATATACAGATGAAGAGTACCAGAAGTACGCTTCTCAATATAACAAACAA
GATGATGGCCCGACCTGGAGCTTGGCTCATCCACTGCCCCATATAGTCCGGCCCGGCATGCGTCACGGCGCCTTG
CCAGAGGACCGAAAAGAGGATCGAAAAGAGGATAGAGACGGCACGACAGAGAACCAGCAGGATTCAGCGCACGAG
GAGGAAGTTCGCAAACAGCAGTCGTCAGAAAATCGAACGAAGAAGGTCAACGACCCCAAAGAAGACGGCTTTTTC
AATACATGGTCGAAAATTCGCCACCAACTTCGTGAGCCGCTGGCCGAATGGCTCGGAACAACTATGGCAATGACA
ATTGGTCTTTGCGCGACCTTATCAAACTTCACTTCCTCCGGACAAGCCGGATCATACCCTGCCCAAAGTCTCGCC
TGGGGCTTTGGATTCATGGTCGCTATCTACACCACCGGAGGTATGTCTGGTGGTCATTTAAACCCAGCCATCTCA
ATCTCGCTGTCTGTATTCCGTGGATTCCCCGCGCGGCGATGCGTGATCTACATTGCCGCGCAACTCCTCGGAGCT
ATCACCGCAGGGGGAATATCATACGCGATCTACCATGACGCCATTGTTGAAGTCGCCAGATTGGCGAACGTGCCT
CAGAATGCAAGTGTCGCCTCGCAGGCTCTCCTCACGTTACCGAAACCATTTGTCCGTCCTGCGACTGCATTCTTC
ACCGAGTTTGTCGGCAGCGCAATATTACTTGGCTCGATTCTAGCTCTGGGGGATGACACTAATGCGCCCCCGGGA
GCAGGAATGCAGGCATTTATTATTGGGATCATTATCTCGATTGTGATCCTTGCACTTGGGTATAATACCGGAGGT
TGTTTCAATGGCGCACGAGACTTTGGCCCACGGCTTGTTGCCCTCATGGCTGGATGGGGTGGCAATATCTTCCGA
GAATACCATGCATGGTGGGTTTGGGGACCATGGATCGCAGACATCACCGGTGGATTGTTTGGCGCATTGATCTAT
GATATGGCTATCTTTACCGGTGGTGAGAGTCCAGTCAACTATCCCCCGCGGAGACGAAAGCGGGCATACCGTGTG
AGAGCCTTGAATTTTCGGAAGAAGCTTCGTATTGGGAGAAAAAAGCTGCCCGATCTTGAACGTTCTGTTGCAGCT
ACTGAGCAATGA
Transcript >Pro_DTO377G3_2|g3556.t1
ATGGGAAACTCGAGGGAACCTGGCCGGGATGGCGGAGTCAAGGATGCTGTGGATGCTCCCGAATATGAGCAACCA
GAAGGCACCGAAGAAGAAGCAAGCAAGAATGAAGGCATGGGCAAAAACCCATCATATAGTTTGGCTGGCTCTGGC
GCACAGAATCCAAACAACAACCAAGGATATACAGATGAAGAGTACCAGAAGTACGCTTCTCAATATAACAAACAA
GATGATGGCCCGACCTGGAGCTTGGCTCATCCACTGCCCCATATAGTCCGGCCCGGCATGCGTCACGGCGCCTTG
CCAGAGGACCGAAAAGAGGATCGAAAAGAGGATAGAGACGGCACGACAGAGAACCAGCAGGATTCAGCGCACGAG
GAGGAAGTTCGCAAACAGCAGTCGTCAGAAAATCGAACGAAGAAGGTCAACGACCCCAAAGAAGACGGCTTTTTC
AATACATGGTCGAAAATTCGCCACCAACTTCGTGAGCCGCTGGCCGAATGGCTCGGAACAACTATGGCAATGACA
ATTGGTCTTTGCGCGACCTTATCAAACTTCACTTCCTCCGGACAAGCCGGATCATACCCTGCCCAAAGTCTCGCC
TGGGGCTTTGGATTCATGGTCGCTATCTACACCACCGGAGGTATGTCTGGTGGTCATTTAAACCCAGCCATCTCA
ATCTCGCTGTCTGTATTCCGTGGATTCCCCGCGCGGCGATGCGTGATCTACATTGCCGCGCAACTCCTCGGAGCT
ATCACCGCAGGGGGAATATCATACGCGATCTACCATGACGCCATTGTTGAAGTCGCCAGATTGGCGAACGTGCCT
CAGAATGCAAGTGTCGCCTCGCAGGCTCTCCTCACGTTACCGAAACCATTTGTCCGTCCTGCGACTGCATTCTTC
ACCGAGTTTGTCGGCAGCGCAATATTACTTGGCTCGATTCTAGCTCTGGGGGATGACACTAATGCGCCCCCGGGA
GCAGGAATGCAGGCATTTATTATTGGGATCATTATCTCGATTGTGATCCTTGCACTTGGGTATAATACCGGAGGT
TGTTTCAATGGCGCACGAGACTTTGGCCCACGGCTTGTTGCCCTCATGGCTGGATGGGGTGGCAATATCTTCCGA
GAATACCATGCATGGTGGGTTTGGGGACCATGGATCGCAGACATCACCGGTGGATTGTTTGGCGCATTGATCTAT
GATATGGCTATCTTTACCGGTGGTGAGAGTCCAGTCAACTATCCCCCGCGGAGACGAAAGCGGGCATACCGTGTG
AGAGCCTTGAATTTTCGGAAGAAGCTTCGTATTGGGAGAAAAAAGCTGCCCGATCTTGAACGTTCTGTTGCAGCT
ACTGAGCAATGA
Gene >Pro_DTO377G3_2|g3556.t1
ATGGGAAACTCGAGGGAACCTGGCCGGGATGGCGGAGTCAAGGGTATGATACAGGTTTGAAGGGATTGCTGCGAG
ATAGCAATAATGCTGATACAACGACAGATGCTGTGGATGCTCCCGAATATGAGCAACCAGAAGGCACCGAAGAAG
AAGCAAGCAAGAATGAAGGCATGGGCAAAAACCCATCATATAGTTTGGCTGGCTCTGGCGCACAGAATCCAAACA
ACAACCAAGGATATACAGATGAAGAGTACCAGAAGTACGCTTCTCAATATAACAAACAAGATGATGGCCCGACCT
GGAGCTTGGCTCATCCACTGCCCCATATAGTCCGGCCCGGCATGCGTCACGGCGCCTTGCCAGAGGACCGAAAAG
AGGATCGAAAAGAGGATAGAGACGGCACGACAGAGAACCAGCAGGATTCAGCGCACGAGGAGGAAGTTCGCAAAC
AGCAGTCGTCAGAAAATCGAACGAAGAAGGTCAACGACCCCAAAGAAGACGGCTTTTTCAATACATGGTCGAAAA
TTCGCCACCAACTTCGTGAGCCGCTGGCCGAATGGCTCGGAGTAAGTTTTATCGATATGGCTCAAAAATACAATC
AATCAAGCAGTCTGCTAACAAGTGTCTCGCACAGACAACTATGGCAATGACAATTGGTCTTTGCGCGACCTTATC
AAACTTCACTTCCTCCGGACAAGCCGGATCATACCCTGCCCAAAGTCTCGCCTGGGGCTTTGGATTCATGGTCGC
TATCTACACCACCGGAGGTATGTCTGGTGGTCATTTAAACCCAGCCATCTCAATCTCGCTGTCTGTATTCCGTGG
ATTCCCCGCGCGGCGATGCGTGATCTACATTGCCGCGCAACTCCTCGGAGCTATCACCGCAGGGGGAATATCATA
CGCGATCTACCATGACGCCATTGTTGAAGTCGCCAGATTGGCGAACGTGCCTCAGAATGCAAGTGTCGCCTCGCA
GGCTCTCCTCACGTTACCGAAACCATTTGTCCGTCCTGCGACTGCATTCTTCACCGAGTTTGTCGGCAGCGCAAT
ATTACTTGGCTCGATTCTAGCTCTGGGGGATGACACTAATGCGCCCCCGGGAGCAGGAATGCAGGCATTTATTAT
TGGGATCATTATCTCGATTGTGATCCTTGCACTTGGGTATAATACCGGAGGGTATGTGTCCTATTTCTAAACTCC
CGATTCTAAGTGCTTTCGAAGATAACTAATGATCTGATAGTTGTTTCAATGGCGCACGAGACTTTGGCCCACGGC
TTGTTGCCCTCATGGCTGGATGGGGTGGCAATATCTTCCGAGAATACCATGCATGGTGGGTTTGGGGACCATGGA
TCGCAGACATCACCGGTGGATTGTTTGGCGCATTGATCTATGATATGGCTATCTTTACCGGTGGTGAGAGTCCAG
TCAACTATCCCCCGCGGAGACGAAAGCGGGCATACCGTGTGAGAGCCTTGAATTTTCGGAAGAAGCTTCGTATTG
GGAGAAAAAAGCTGCCCGATCTTGAACGTTCTGTTGCAGCTACTGAGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail