Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3550.t1
Gene name
Locationscaffold_06:73411..78309
Strand-
Gene length (bp)4898
Transcript length (bp)3390
Coding sequence length (bp)3390
Protein length (aa) 1130

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05916 Sld5 GINS complex protein 4.7E-20 45 155
PF07989 Cnn_1N Centrosomin N-terminal motif 1 2.7E-07 352 441

GO

GO Term Description Terminal node
GO:0005815 microtubule organizing center Yes
GO:0044430 cytoskeletal part No
GO:0044424 intracellular part No
GO:0005575 cellular_component No
GO:0044422 organelle part No
GO:0044446 intracellular organelle part No
GO:0044464 cell part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3550.t1
MSYYDIDSILTDAQKLPCTFELEVPGLGILEGNAGEDIKAGTRIDLPLWLGEMLSIGARLGTARLVTLDMPEALS
ERVMNALKADPRTVDLRALAPHFYNLSERILELFEEEEMVDVLSDTFKKRAAEIADHARNSRGAVGGGVEFLRGL
DETERQLFRAAHDRAKDMRIWSGEAKLIMDEKTQRRSSAAGQLAPSNTRSPVYHPSTAPKRSVSSKDHSSNLSDR
PQHPSLSRVKGRSNMFTPPRMSPEVSWLGDQSPVQRGARTPVRSSTSETPEPSTPTLVNPASALLQDLLKEERAH
RSSRGTISEDFKENAPLTPENTRTQEEPTSEKARKANDVFSAGQRKPKEMGMREMDQYVSKMNKLNFDLKLEVFH
RTQQLAMYEKKLERMAEMEEQLAHMDDLMAEVEELRTTEKENQTLRESNEQLRNDLDKRDLAVTEAVELICQLES
KLDLLENGRGSRLSMSRPMTADGSEALAKAQAMIEIPERTSSKRNASVLNVAQNQSSSELRRLSKAPSFLRADNK
STATLRSLYAPEEETQSRSARTELSKSESFHTNNEMMEPESPRLSVLSECSELNAFDTPMMWQEFDQLEIPVRRP
SSVAGSLDSYVTPREREESRKDKIDRWMQSREDVSETIINRRRNRVSSDATKASVASFSPDLYASKPRGRGRLDG
SLFGGIHLPPTPDTMSTAYAIGANRSNGSDGSIAARKGSQTEDLFFPGRRLNRPRSAGEMACPYSYGSDIDDSMQ
NNCNDTPRLGVADESRTILPSFNTVSSKASALLGPGSPDNPVIETFGDLYHASANEGSTQTIKRVRSPAKAKTPE
PHSDSDSSPPLTPQDWVAAAKHPRSRRPRPRDTRHEIQPTDLSPGTVISPAFEDDSSLASGSSELEITGIPTLDM
STLDILARGLEPTQPGPKVEAKHEHRRRLSFLPPFFNRSSSNARQLQGSPVLNDFEDDFDDGAPSPVIPKTRTTG
GAPRRPASQIITAPTELYPSNPPIHIEEPPAAFRRGFPQSATMSTLADHGTETLARPSSSQGPEHKRRSSLGIFG
WMKSKRSDSGPGTEKFTDSTSKENRASSRLAYETTHGLGIPHGNTDSMETHVRHHSEMGIQYDDYARRPRYMGRR
TRRG*
Coding >Pro_DTO377G3_2|g3550.t1
ATGTCTTACTATGATATTGACTCCATCTTGACGGATGCACAGAAACTACCATGTACATTTGAGCTCGAAGTACCC
GGACTGGGTATTCTAGAGGGCAACGCGGGCGAAGATATCAAAGCCGGAACCCGGATCGACCTTCCACTATGGCTA
GGTGAAATGCTCTCGATCGGAGCGCGTCTAGGAACGGCCCGCTTGGTTACGCTCGACATGCCCGAGGCGCTCTCG
GAGCGGGTGATGAACGCACTGAAGGCCGATCCCCGCACAGTTGACTTGCGCGCTTTAGCACCGCATTTCTACAAC
CTTAGCGAGCGGATTCTTGAACTCTTCGAGGAGGAAGAGATGGTCGATGTTCTCAGTGATACATTCAAAAAACGA
GCGGCTGAGATTGCCGACCATGCACGCAACTCGCGTGGTGCGGTTGGTGGCGGAGTTGAGTTCCTTCGTGGACTG
GATGAGACTGAGCGACAATTGTTCCGGGCTGCTCATGACCGGGCCAAGGACATGCGGATCTGGTCAGGAGAGGCG
AAACTCATTATGGATGAGAAAACCCAAAGAAGGAGCTCGGCCGCTGGTCAGCTTGCTCCTTCAAACACTCGAAGT
CCCGTATATCATCCCAGCACTGCGCCCAAACGCAGTGTTTCCTCTAAAGACCACTCCTCTAACTTATCAGACCGT
CCTCAACATCCATCGCTTTCTCGCGTCAAAGGTCGATCGAATATGTTTACTCCACCAAGAATGAGTCCAGAGGTC
TCATGGCTAGGAGACCAATCGCCTGTTCAACGGGGCGCAAGAACCCCAGTCCGCTCATCCACATCCGAAACCCCC
GAACCTAGCACCCCTACTCTAGTAAACCCTGCCTCGGCTCTCCTGCAGGATCTACTGAAAGAAGAACGCGCGCAC
CGAAGCTCCCGAGGAACCATATCGGAGGACTTTAAAGAAAATGCTCCTCTCACTCCGGAGAACACTCGAACCCAG
GAAGAACCTACCTCCGAGAAAGCCCGCAAAGCAAACGATGTCTTCTCCGCTGGCCAGAGAAAACCGAAAGAGATG
GGCATGCGGGAAATGGACCAATATGTCTCCAAAATGAACAAGCTGAATTTCGATTTGAAGCTCGAGGTCTTCCAC
CGCACACAACAGTTGGCTATGTACGAGAAAAAGCTGGAAAGAATGGCGGAGATGGAAGAACAACTAGCGCACATG
GATGATTTGATGGCGGAGGTGGAGGAGCTACGAACCACCGAGAAAGAGAACCAGACCCTACGTGAATCTAACGAG
CAACTCCGCAACGACCTTGACAAGCGAGACCTGGCGGTGACTGAAGCCGTCGAGCTCATCTGCCAGTTGGAATCG
AAACTTGACCTGCTGGAGAACGGCCGGGGCTCCAGGCTGTCTATGTCGCGCCCCATGACCGCCGATGGCTCTGAG
GCCTTAGCTAAAGCCCAGGCCATGATCGAGATCCCGGAGAGAACCTCTTCCAAGCGAAATGCAAGTGTCTTGAAC
GTAGCTCAGAACCAGTCATCTTCCGAGCTACGCAGACTCTCGAAAGCACCCTCCTTCCTACGAGCAGATAACAAA
AGTACTGCCACTTTGCGGAGCCTTTATGCTCCTGAAGAAGAAACCCAGTCGCGCTCTGCAAGAACTGAACTTTCG
AAATCCGAGAGCTTCCACACAAACAACGAGATGATGGAGCCGGAATCACCGAGACTGAGCGTCCTGAGTGAATGC
AGCGAGCTGAATGCATTCGACACGCCTATGATGTGGCAAGAATTTGATCAGCTGGAGATCCCGGTCCGGAGACCG
TCGTCGGTCGCAGGCAGCTTGGATAGCTATGTCACTCCCCGAGAGCGGGAAGAAAGCAGAAAAGACAAGATTGAC
CGGTGGATGCAGTCCCGCGAAGACGTAAGCGAGACCATTATCAACAGACGCAGGAACCGAGTATCATCCGATGCT
ACCAAGGCGAGCGTTGCCAGTTTCTCACCAGATCTATACGCTTCTAAACCTCGTGGACGCGGACGACTGGACGGA
TCTCTTTTCGGAGGCATCCACCTTCCTCCCACCCCCGACACTATGAGCACGGCATATGCTATCGGTGCAAACCGA
TCGAATGGGTCCGATGGGAGTATTGCAGCCCGGAAGGGCTCCCAGACTGAGGATTTGTTCTTCCCTGGCAGACGA
CTTAATCGCCCACGTTCTGCTGGAGAGATGGCCTGTCCCTACAGCTATGGCAGTGACATTGACGACAGCATGCAA
AACAACTGCAATGATACTCCGCGCCTAGGAGTCGCTGATGAGTCTCGCACTATCCTGCCCTCCTTCAACACAGTT
TCCTCCAAAGCCAGCGCGCTCCTTGGGCCCGGAAGCCCCGACAACCCTGTTATTGAAACCTTTGGGGATTTATAC
CACGCCAGTGCAAACGAAGGATCCACTCAAACAATCAAACGCGTCCGTAGCCCCGCCAAAGCTAAGACCCCAGAG
CCGCACAGTGACAGCGACTCTTCACCACCACTCACACCTCAAGACTGGGTTGCCGCTGCAAAGCATCCCCGGTCT
CGCAGGCCCAGACCGCGCGACACCCGCCACGAAATCCAACCCACAGATCTATCACCAGGCACTGTCATCAGTCCA
GCATTTGAAGACGACAGCAGCCTCGCTTCAGGTTCAAGCGAGCTCGAAATCACCGGTATCCCAACTCTAGATATG
AGCACTCTGGATATACTAGCGCGAGGCCTCGAACCCACCCAGCCAGGCCCCAAAGTCGAAGCCAAGCACGAGCAT
CGTCGACGTCTCAGCTTCCTACCCCCATTCTTCAACCGCTCGAGCTCCAACGCCCGCCAACTCCAAGGCTCCCCA
GTCTTGAACGACTTCGAAGACGACTTCGACGACGGCGCTCCATCCCCAGTAATCCCCAAAACCAGGACAACAGGC
GGCGCGCCCCGAAGACCAGCATCCCAAATAATCACCGCTCCAACCGAGCTATACCCCTCCAACCCCCCAATCCAC
ATCGAAGAACCGCCCGCGGCCTTCAGACGCGGATTCCCGCAATCAGCAACAATGTCCACACTAGCGGACCACGGC
ACCGAAACCCTCGCGCGCCCCTCCTCATCCCAAGGCCCGGAACACAAGCGACGCAGCTCGCTAGGAATATTCGGC
TGGATGAAGAGCAAACGCTCTGATTCCGGGCCCGGGACGGAGAAATTCACGGACTCCACGTCCAAAGAGAACCGC
GCTTCCTCGCGGCTAGCTTACGAAACGACTCATGGGCTTGGAATTCCTCATGGAAACACGGACTCCATGGAGACT
CATGTCAGACACCACTCCGAGATGGGTATTCAGTATGATGACTATGCGAGACGGCCTCGTTATATGGGCCGTCGT
ACACGCAGGGGCTGA
Transcript >Pro_DTO377G3_2|g3550.t1
ATGTCTTACTATGATATTGACTCCATCTTGACGGATGCACAGAAACTACCATGTACATTTGAGCTCGAAGTACCC
GGACTGGGTATTCTAGAGGGCAACGCGGGCGAAGATATCAAAGCCGGAACCCGGATCGACCTTCCACTATGGCTA
GGTGAAATGCTCTCGATCGGAGCGCGTCTAGGAACGGCCCGCTTGGTTACGCTCGACATGCCCGAGGCGCTCTCG
GAGCGGGTGATGAACGCACTGAAGGCCGATCCCCGCACAGTTGACTTGCGCGCTTTAGCACCGCATTTCTACAAC
CTTAGCGAGCGGATTCTTGAACTCTTCGAGGAGGAAGAGATGGTCGATGTTCTCAGTGATACATTCAAAAAACGA
GCGGCTGAGATTGCCGACCATGCACGCAACTCGCGTGGTGCGGTTGGTGGCGGAGTTGAGTTCCTTCGTGGACTG
GATGAGACTGAGCGACAATTGTTCCGGGCTGCTCATGACCGGGCCAAGGACATGCGGATCTGGTCAGGAGAGGCG
AAACTCATTATGGATGAGAAAACCCAAAGAAGGAGCTCGGCCGCTGGTCAGCTTGCTCCTTCAAACACTCGAAGT
CCCGTATATCATCCCAGCACTGCGCCCAAACGCAGTGTTTCCTCTAAAGACCACTCCTCTAACTTATCAGACCGT
CCTCAACATCCATCGCTTTCTCGCGTCAAAGGTCGATCGAATATGTTTACTCCACCAAGAATGAGTCCAGAGGTC
TCATGGCTAGGAGACCAATCGCCTGTTCAACGGGGCGCAAGAACCCCAGTCCGCTCATCCACATCCGAAACCCCC
GAACCTAGCACCCCTACTCTAGTAAACCCTGCCTCGGCTCTCCTGCAGGATCTACTGAAAGAAGAACGCGCGCAC
CGAAGCTCCCGAGGAACCATATCGGAGGACTTTAAAGAAAATGCTCCTCTCACTCCGGAGAACACTCGAACCCAG
GAAGAACCTACCTCCGAGAAAGCCCGCAAAGCAAACGATGTCTTCTCCGCTGGCCAGAGAAAACCGAAAGAGATG
GGCATGCGGGAAATGGACCAATATGTCTCCAAAATGAACAAGCTGAATTTCGATTTGAAGCTCGAGGTCTTCCAC
CGCACACAACAGTTGGCTATGTACGAGAAAAAGCTGGAAAGAATGGCGGAGATGGAAGAACAACTAGCGCACATG
GATGATTTGATGGCGGAGGTGGAGGAGCTACGAACCACCGAGAAAGAGAACCAGACCCTACGTGAATCTAACGAG
CAACTCCGCAACGACCTTGACAAGCGAGACCTGGCGGTGACTGAAGCCGTCGAGCTCATCTGCCAGTTGGAATCG
AAACTTGACCTGCTGGAGAACGGCCGGGGCTCCAGGCTGTCTATGTCGCGCCCCATGACCGCCGATGGCTCTGAG
GCCTTAGCTAAAGCCCAGGCCATGATCGAGATCCCGGAGAGAACCTCTTCCAAGCGAAATGCAAGTGTCTTGAAC
GTAGCTCAGAACCAGTCATCTTCCGAGCTACGCAGACTCTCGAAAGCACCCTCCTTCCTACGAGCAGATAACAAA
AGTACTGCCACTTTGCGGAGCCTTTATGCTCCTGAAGAAGAAACCCAGTCGCGCTCTGCAAGAACTGAACTTTCG
AAATCCGAGAGCTTCCACACAAACAACGAGATGATGGAGCCGGAATCACCGAGACTGAGCGTCCTGAGTGAATGC
AGCGAGCTGAATGCATTCGACACGCCTATGATGTGGCAAGAATTTGATCAGCTGGAGATCCCGGTCCGGAGACCG
TCGTCGGTCGCAGGCAGCTTGGATAGCTATGTCACTCCCCGAGAGCGGGAAGAAAGCAGAAAAGACAAGATTGAC
CGGTGGATGCAGTCCCGCGAAGACGTAAGCGAGACCATTATCAACAGACGCAGGAACCGAGTATCATCCGATGCT
ACCAAGGCGAGCGTTGCCAGTTTCTCACCAGATCTATACGCTTCTAAACCTCGTGGACGCGGACGACTGGACGGA
TCTCTTTTCGGAGGCATCCACCTTCCTCCCACCCCCGACACTATGAGCACGGCATATGCTATCGGTGCAAACCGA
TCGAATGGGTCCGATGGGAGTATTGCAGCCCGGAAGGGCTCCCAGACTGAGGATTTGTTCTTCCCTGGCAGACGA
CTTAATCGCCCACGTTCTGCTGGAGAGATGGCCTGTCCCTACAGCTATGGCAGTGACATTGACGACAGCATGCAA
AACAACTGCAATGATACTCCGCGCCTAGGAGTCGCTGATGAGTCTCGCACTATCCTGCCCTCCTTCAACACAGTT
TCCTCCAAAGCCAGCGCGCTCCTTGGGCCCGGAAGCCCCGACAACCCTGTTATTGAAACCTTTGGGGATTTATAC
CACGCCAGTGCAAACGAAGGATCCACTCAAACAATCAAACGCGTCCGTAGCCCCGCCAAAGCTAAGACCCCAGAG
CCGCACAGTGACAGCGACTCTTCACCACCACTCACACCTCAAGACTGGGTTGCCGCTGCAAAGCATCCCCGGTCT
CGCAGGCCCAGACCGCGCGACACCCGCCACGAAATCCAACCCACAGATCTATCACCAGGCACTGTCATCAGTCCA
GCATTTGAAGACGACAGCAGCCTCGCTTCAGGTTCAAGCGAGCTCGAAATCACCGGTATCCCAACTCTAGATATG
AGCACTCTGGATATACTAGCGCGAGGCCTCGAACCCACCCAGCCAGGCCCCAAAGTCGAAGCCAAGCACGAGCAT
CGTCGACGTCTCAGCTTCCTACCCCCATTCTTCAACCGCTCGAGCTCCAACGCCCGCCAACTCCAAGGCTCCCCA
GTCTTGAACGACTTCGAAGACGACTTCGACGACGGCGCTCCATCCCCAGTAATCCCCAAAACCAGGACAACAGGC
GGCGCGCCCCGAAGACCAGCATCCCAAATAATCACCGCTCCAACCGAGCTATACCCCTCCAACCCCCCAATCCAC
ATCGAAGAACCGCCCGCGGCCTTCAGACGCGGATTCCCGCAATCAGCAACAATGTCCACACTAGCGGACCACGGC
ACCGAAACCCTCGCGCGCCCCTCCTCATCCCAAGGCCCGGAACACAAGCGACGCAGCTCGCTAGGAATATTCGGC
TGGATGAAGAGCAAACGCTCTGATTCCGGGCCCGGGACGGAGAAATTCACGGACTCCACGTCCAAAGAGAACCGC
GCTTCCTCGCGGCTAGCTTACGAAACGACTCATGGGCTTGGAATTCCTCATGGAAACACGGACTCCATGGAGACT
CATGTCAGACACCACTCCGAGATGGGTATTCAGTATGATGACTATGCGAGACGGCCTCGTTATATGGGCCGTCGT
ACACGCAGGGGCTGA
Gene >Pro_DTO377G3_2|g3550.t1
ATGTCTTACTATGATATTGACTCCATCTTGACGGATGCACAGGTGAGTTAGTCGCGACCCGCAAAAATGAACCAT
TACTAACATCGACCCAGAAACTACCATGTACATTTGAGCTCGAAGTACCCGGACTGGGTATTCTAGAGGGCAACG
CGGGCGAAGATGCGAGTGCTCTATTTTTCACTATCCGGCGACACAGATTACTGACCGATGCACAGATCAAAGCCG
GAACCCGGATCGACCTTCCACTATGGCTAGGTGAAATGCTCTCGATCGGGTAAGGTTCTTACCTAGAAGACCAGC
GTGGAGTTTGTTCTTATTTTTAACATGGTATTTATGGCTGCAGAGCGCGTCTAGGAACGGCCCGCTTGGTTACGC
TCGACATGCCCGAGGCGCTCTCGGAGCGGGTGATGAACGCACTGAAGGCCGATCCCCGCACAGTTGACTTGCGCG
CTTTAGCACCGCATTTCTACAACCTTAGCGAGCGGATTCTTGAACTCTTCGAGGAGGAAGAGATGGTCGATGTTC
TCAGTGATGTAGGTGGCATTATTTCCGCGACTATTGGTTGAGCTAGGATTAACAGGCTCTTAGACATTCAAAAAA
CGAGCGGCTGAGATTGCCGACCATGCACGCAACTCGCGTGGTGCGGTTGGTGGCGGAGTTGAGTTCCTTCGTGGA
CTGGATGAGACTGAGCGACAATGTAGGTTATGATTGTCCTTATTTGGATGGGGGATGGCCGCTAACAGATATGGT
TCAATAGTGTTCCGGGCTGCTCATGACCGGGCCAAGGACATGCGGATCTGGTCAGGAGAGGCGAAACGTAAGTAA
TAGTGTTTAATAGCGAGACATTTCTCTGGGCTCTGAGCTGTGCTCGCTCAGGAAAGTGATACATTCTATGATCGA
TCGGATAGGTATATGACAGAGTATGAAGGATATGAGATGGCTGGGTGGAGTCGCATAGTTTAATGTTGAGACGTT
GACTTCCGAAGGCGACGGAGTGGAGCCCCGACCCGTCGAAAGGGAAATGTTTATTTTTGTATAGCCGACCTCTGG
GATTGAAATATTGTTTCTCCTTTGTGATGATTGATATATACACCCAAGACACACACATCCTGCCCTCTATCCCAA
CACCAAATCCAACATTCAGGAGAAACCCCGCGCAAGGGCCAGGTGAGACGCGCCCCACGGCCCCGGTCCGATTGG
CCGTCGACGGGCGAGAGAGACACCACCGGAGTGATCGTCGCGTTAAGGAGCCGATTGACTGGAATCTAGCCTCGG
GGCTGGAAAAAGAGAAAAAACTATTTAGAAATCACCAGATGGGGATCTGATGTTTCTTCCATTCCTGGCCTCTTT
CCATTCTTCCTCTCATAACAATAACATCTACAACATACACAAACATTCAAATCTAGTGCGGGGCCCTTTCCTCTC
TTTGGAGATCGACTCGTCACAACTCGTTGGTCACTTCACCCTCGCGTTTGACTGATCCCAAGTCCCGCTCCTCCC
TTGAGTTGGCAGCCTGAGACCCCTCTATGCCTTGATTTGGGTCTATTGCCTCGATAAACCTACCTTGCACTCCAC
AGGTTCGATTCCAGCCTCTGATTGCTCCCCACCTGCAACTCATCTGCATCCCTCGCATCGACGGCCTGCGTGTTA
CCCACCGGCGTCCAATCACCGTCCATATCCGAGGGTCCATCTATTAATCCTCCGATGCGGGTGGTGGATTGTGCA
GGCAATTGTTACTGTGGTGTCTCCTGATTGACTAGGATATTGCACGGCTGCATCCAAACAGGGGAACGGGGGGCT
TGACGGCACGTCAATTATGCGCGTTCGCTAAAACAGTATGCCGGCAGTCATTATGGATGAGAAAACCCAAAGAAG
GAGCTCGGCCGCTGGTCAGCTTGCTCCTTCAAACACTCGAAGTCCCGTATATCATCCCAGCACTGCGCCCAAACG
CAGTGTTTCCTCTAAAGACCACTCCTCTAGTACGTGGCTTCTAAACTTGCTTGAATTGAGTTCCAACACTCAGCC
TTAATTTAATCGGAGCTGACATTGCTTCTTCTTCAAGACTTATCAGACCGTCCTCAACATCCATCGCTTTCTCGC
GTCAAAGGTCGATCGAATATGTTTACTCCACCAAGAATGAGTCCAGAGGTCTCATGGCTAGGAGACCAATCGCCT
GTTCAACGGGGCGCAAGAACCCCAGTCCGCTCATCCACATCCGGTATGTCTTTCAATTGCCATCGACCTCGGCTG
TAGAGCACAACTGATGATTCGTGGCTAGAAACCCCCGAACCTAGCACCCCTACTCTAGTAAACCCTGCCTCGGCT
CTCCTGCAGGATCTACTGAAAGAAGAACGCGCGCACCGAAGCTCCCGAGGAACCATATCGGAGGACTTTAAAGAA
AATGCTCCTCTCACTCCGGAGAACACTCGAACCCAGGAAGAACCTACCTCCGAGAAAGCCCGCAAAGCAAACGAT
GTCTTCTCCGCTGGCCAGAGAAAACCGAAAGAGATGGGCATGCGGGAAATGGACCAAGTAAGTTCATAAGACGCA
ATCCCTGTGCACTAGCTGACTCGTCTAAGTATGTCTCCAAAATGAACAAGCTGAATTTCGATTTGAAGCTCGAGG
TCTTCCACCGCACACAACAGTTGGCTATGTACGAGAAAAAGCTGGAAAGAATGGCGGAGATGGAAGAACAACTAG
CGCACATGGATGATTTGATGGCGGAGGTGGAGGAGCTACGAACCACCGAGAAAGAGAACCAGACCCTACGTGAAT
CTAACGAGCAACTCCGCAACGACCTTGACAAGCGAGACCTGGCGGTGACTGAAGCCGTCGAGCTCATCTGCCAGT
TGGAATCGAAACTTGACCTGCTGGAGAACGGCCGGGGCTCCAGGCTGTCTATGTCGCGCCCCATGACCGCCGATG
GCTCTGAGGCCTTAGCTAAAGCCCAGGCCATGATCGAGATCCCGGAGAGAACCTCTTCCAAGCGAAATGCAAGTG
TCTTGAACGTAGCTCAGAACCAGTCATCTTCCGAGCTACGCAGACTCTCGAAAGCACCCTCCTTCCTACGAGCAG
ATAACAAAAGTACTGCCACTTTGCGGAGCCTTTATGCTCCTGAAGAAGAAACCCAGTCGCGCTCTGCAAGAACTG
AACTTTCGAAATCCGAGAGCTTCCACACAAACAACGAGATGATGGAGCCGGAATCACCGAGACTGAGCGTCCTGA
GTGAATGCAGCGAGCTGAATGCATTCGACACGCCTATGATGTGGCAAGAATTTGATCAGCTGGAGATCCCGGTCC
GGAGACCGTCGTCGGTCGCAGGCAGCTTGGATAGCTATGTCACTCCCCGAGAGCGGGAAGAAAGCAGAAAAGACA
AGATTGACCGGTGGATGCAGTCCCGCGAAGACGTAAGCGAGACCATTATCAACAGACGCAGGAACCGAGTATCAT
CCGATGCTACCAAGGCGAGCGTTGCCAGTTTCTCACCAGATCTATACGCTTCTAAACCTCGTGGACGCGGACGAC
TGGACGGATCTCTTTTCGGAGGCATCCACCTTCCTCCCACCCCCGACACTATGAGCACGGCATATGCTATCGGTG
CAAACCGATCGAATGGGTCCGATGGGAGTATTGCAGCCCGGAAGGGCTCCCAGACTGAGGATTTGTTCTTCCCTG
GCAGACGACTTAATCGCCCACGTTCTGCTGGAGAGATGGCCTGTCCCTACAGCTATGGCAGTGACATTGACGACA
GCATGCAAAACAACTGCAATGATACTCCGCGCCTAGGAGTCGCTGATGAGTCTCGCACTATCCTGCCCTCCTTCA
ACACAGTTTCCTCCAAAGCCAGCGCGCTCCTTGGGCCCGGAAGCCCCGACAACCCTGTTATTGAAACCTTTGGGG
ATTTATACCACGCCAGTGCAAACGAAGGATCCACTCAAACAATCAAACGCGTCCGTAGCCCCGCCAAAGCTAAGA
CCCCAGAGCCGCACAGTGACAGCGACTCTTCACCACCACTCACACCTCAAGACTGGGTTGCCGCTGCAAAGCATC
CCCGGTCTCGCAGGCCCAGACCGCGCGACACCCGCCACGAAATCCAACCCACAGATCTATCACCAGGCACTGTCA
TCAGTCCAGCATTTGAAGACGACAGCAGCCTCGCTTCAGGTTCAAGCGAGCTCGAAATCACCGGTATCCCAACTC
TAGATATGAGCACTCTGGATATACTAGCGCGAGGCCTCGAACCCACCCAGCCAGGCCCCAAAGTCGAAGCCAAGC
ACGAGCATCGTCGACGTCTCAGCTTCCTACCCCCATTCTTCAACCGCTCGAGCTCCAACGCCCGCCAACTCCAAG
GCTCCCCAGTCTTGAACGACTTCGAAGACGACTTCGACGACGGCGCTCCATCCCCAGTAATCCCCAAAACCAGGA
CAACAGGCGGCGCGCCCCGAAGACCAGCATCCCAAATAATCACCGCTCCAACCGAGCTATACCCCTCCAACCCCC
CAATCCACATCGAAGAACCGCCCGCGGCCTTCAGACGCGGATTCCCGCAATCAGCAACAATGTCCACACTAGCGG
ACCACGGCACCGAAACCCTCGCGCGCCCCTCCTCATCCCAAGGCCCGGAACACAAGCGACGCAGCTCGCTAGGAA
TATTCGGCTGGATGAAGAGCAAACGCTCTGATTCCGGGCCCGGGACGGAGAAATTCACGGACTCCACGTCCAAAG
AGAACCGCGCTTCCTCGCGGCTAGCTTACGAAACGACTCATGGGCTTGGAATTCCTCATGGAAACACGGACTCCA
TGGAGACTCATGTCAGACACCACTCCGAGATGGGTATTCAGTATGATGACTATGCGAGACGGCCTCGTTATATGG
GCCGTCGTACACGCAGGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail