Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3532.t1
Gene name
Locationscaffold_06:31734..34190
Strand-
Gene length (bp)2456
Transcript length (bp)2331
Coding sequence length (bp)2331
Protein length (aa) 777

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.8E-10 553 613
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.0E-18 557 645
PF12796 Ank_2 Ankyrin repeats (3 copies) 9.0E-15 615 678
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.1E-15 640 712
PF12796 Ank_2 Ankyrin repeats (3 copies) 6.3E-13 672 742
PF13637 Ank_4 Ankyrin repeats (many copies) 6.3E-05 560 603
PF13637 Ank_4 Ankyrin repeats (many copies) 1.0E-09 585 636
PF13637 Ank_4 Ankyrin repeats (many copies) 1.5E-06 618 661
PF13637 Ank_4 Ankyrin repeats (many copies) 1.2E-10 651 702
PF13606 Ank_3 Ankyrin repeat 3.3E-05 582 609
PF13606 Ank_3 Ankyrin repeat 3.7E-04 616 643
PF13606 Ank_3 Ankyrin repeat 1.9E-04 648 676
PF13606 Ank_3 Ankyrin repeat 2.2E-04 681 708
PF00023 Ank Ankyrin repeat 3.5E-05 582 613
PF00023 Ank Ankyrin repeat 8.2E-04 616 646
PF00023 Ank Ankyrin repeat 2.0E-04 648 680
PF00023 Ank Ankyrin repeat 1.3E-03 681 712
PF00023 Ank Ankyrin repeat 1.4E-02 716 741
PF13857 Ank_5 Ankyrin repeats (many copies) 5.7E-07 569 620
PF13857 Ank_5 Ankyrin repeats (many copies) 4.7E-07 635 686

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3532.t1
MDDIGVLSTSCLSCFDTLTRSLRTSSDEFKKQMRPIAIENEYARFKIWAGNLGALQRGRHSLDARLRDSVVLRAA
VLKFMGELQDSLRKSAEITTGLRLPYEQGGDATHGPDEDAEDNSDTSGTSSDLESAELAERLDEIKDIMEHLYKL
SFKIRNTRYRSLTNKALLMKEEDPQTGKDLFSAYAIFDCRHVQESLNRLRLRPSSKEFVTEPARNPSDGCFDVLN
GGDRLLNSDDFLQDRLAKAITNRRKYFAYWRRHALKLSHVTDELAPQQNFTTLVKPARPVSGPPTTPSISGCSLP
TPGAKTLVSGTDFSLYSHELDDQLDTETVFSYATTAYDVDGNSPELPPPPPDAATKPEFVCQYCWVACPSRQGKG
KSWQEHIRQDLQPYVCTYEECSDADRMHASRHAWLEHERLVHRRIWRCFEHRSFSSKSKNGLLQHFLDCHKGLDE
QQIENLLDIAETTVADDRQTCPFCFSIGPFAKGFHNHVAFHQEQFATFAVPRNFDSNKEADSKKSEGIRSAGSLC
SVALDFSDGDSSLDSDDSDVSVNQLGNSLLNSANFGDAAAVRLLLEKGGNPDLGDNNGQTPLLWAAKKGHEAVVK
LLLEKGADPAFKDHRGQTPLSWAAKKGHEAVVKLLLEKGTDPSLADTYGQTPLSWAAKKGHEAVVKLLLEKGTDP
SLADNDGQTPLLWATINGHKAVVKLLLEKGIDPTLADTYSQTPLSLAAETGHEAVVKRLLDNGADPESIAWAPRS
SESDSELDDSDQGSVIPDRLASEDFT*
Coding >Pro_DTO377G3_2|g3532.t1
ATGGATGACATCGGCGTTCTTTCTACCTCTTGTCTAAGTTGCTTCGATACTCTGACACGATCGCTGCGCACATCT
TCGGATGAGTTCAAGAAACAGATGAGGCCAATAGCAATTGAAAATGAATATGCCCGCTTCAAGATTTGGGCTGGC
AACCTGGGCGCTTTACAGAGAGGCCGGCATTCTCTTGATGCTAGATTACGAGACTCGGTGGTGCTACGAGCAGCC
GTCCTCAAATTCATGGGAGAGTTACAAGACTCTTTGAGAAAGAGTGCCGAGATCACCACAGGTCTTCGCCTACCG
TACGAACAGGGTGGCGATGCCACACATGGTCCCGACGAAGATGCTGAGGACAACAGTGACACTAGTGGCACCAGC
AGTGACTTGGAGTCTGCAGAACTAGCTGAGAGACTCGATGAAATCAAAGATATCATGGAGCACCTGTATAAGCTC
TCCTTCAAGATACGCAACACGAGATATCGTTCTCTCACCAACAAAGCTCTTCTGATGAAAGAAGAGGATCCACAA
ACCGGGAAAGACTTGTTCTCGGCGTATGCCATCTTCGATTGTCGGCATGTACAAGAGTCACTCAATCGCTTGCGC
CTGCGTCCGTCATCAAAGGAATTCGTTACTGAACCTGCACGAAACCCAAGTGACGGGTGTTTCGATGTGTTAAAT
GGTGGGGATCGCCTGTTAAATAGCGACGATTTTCTACAAGATCGCTTAGCAAAAGCAATCACCAACCGCAGAAAG
TATTTTGCATATTGGCGGAGACATGCTCTCAAGCTCTCACACGTTACGGATGAGCTAGCCCCCCAACAAAATTTC
ACAACTCTCGTGAAGCCTGCGAGACCTGTTTCTGGACCTCCAACCACACCCTCAATCTCAGGGTGTTCCCTACCG
ACTCCAGGGGCAAAAACCCTGGTTTCAGGAACCGATTTCTCCTTGTATAGCCATGAATTGGACGACCAGCTGGAT
ACAGAGACCGTGTTTTCCTATGCGACAACAGCCTACGATGTTGACGGAAATTCCCCAGAACTACCTCCACCTCCT
CCCGATGCGGCCACGAAGCCAGAGTTTGTTTGTCAGTATTGCTGGGTGGCTTGTCCGTCGAGACAAGGAAAAGGA
AAGTCATGGCAAGAACATATCCGACAAGATCTCCAGCCGTACGTATGTACCTACGAGGAATGCTCAGATGCCGAC
CGCATGCACGCCAGTCGGCATGCGTGGCTTGAACATGAACGGCTAGTCCACCGCCGAATATGGAGATGCTTCGAA
CACAGGTCCTTCAGCTCCAAATCGAAAAACGGCTTGCTGCAACACTTTTTAGACTGCCACAAAGGTCTAGATGAG
CAGCAGATCGAAAACCTCCTGGATATAGCCGAGACGACGGTAGCCGATGACAGACAAACCTGCCCATTCTGCTTC
TCGATTGGACCTTTTGCTAAGGGGTTTCACAACCACGTGGCTTTCCACCAGGAACAATTCGCAACATTTGCAGTA
CCACGAAACTTTGACAGCAATAAAGAGGCGGACTCTAAAAAATCCGAAGGGATTAGATCAGCTGGATCTTTGTGT
TCCGTTGCTCTAGATTTCTCGGACGGTGATAGCAGCCTTGACAGCGACGACAGCGACGTATCAGTGAACCAACTC
GGAAACTCCCTGCTAAACTCTGCGAATTTCGGAGACGCTGCGGCTGTTAGGCTGCTACTCGAGAAGGGCGGTAAT
CCCGACTTAGGGGATAATAATGGCCAGACACCGCTATTATGGGCGGCTAAGAAAGGCCACGAGGCAGTCGTAAAG
CTACTACTCGAGAAGGGCGCCGATCCTGCCTTTAAGGATCATCGTGGCCAGACGCCGCTATCGTGGGCGGCTAAG
AAGGGCCACGAGGCAGTCGTAAAGCTGCTACTGGAGAAGGGCACCGATCCTTCCTTGGCGGATACTTATGGGCAG
ACGCCGCTATCGTGGGCCGCTAAGAAAGGCCACGAGGCAGTCGTAAAGCTACTACTGGAGAAGGGCACCGATCCT
TCCTTGGCGGATAATGATGGCCAGACACCGCTATTATGGGCGACTATAAATGGCCATAAGGCAGTCGTAAAGCTG
CTACTTGAGAAGGGTATCGATCCTACCTTAGCGGATACTTATAGCCAGACGCCGCTATCGTTAGCGGCTGAGACC
GGCCATGAGGCAGTTGTAAAGCGGCTACTTGACAATGGCGCCGATCCCGAGTCGATAGCGTGGGCGCCTAGGTCT
TCAGAATCAGATTCAGAATTAGACGATTCGGATCAAGGTTCTGTTATTCCCGACCGCCTCGCTTCAGAGGATTTT
ACCTAA
Transcript >Pro_DTO377G3_2|g3532.t1
ATGGATGACATCGGCGTTCTTTCTACCTCTTGTCTAAGTTGCTTCGATACTCTGACACGATCGCTGCGCACATCT
TCGGATGAGTTCAAGAAACAGATGAGGCCAATAGCAATTGAAAATGAATATGCCCGCTTCAAGATTTGGGCTGGC
AACCTGGGCGCTTTACAGAGAGGCCGGCATTCTCTTGATGCTAGATTACGAGACTCGGTGGTGCTACGAGCAGCC
GTCCTCAAATTCATGGGAGAGTTACAAGACTCTTTGAGAAAGAGTGCCGAGATCACCACAGGTCTTCGCCTACCG
TACGAACAGGGTGGCGATGCCACACATGGTCCCGACGAAGATGCTGAGGACAACAGTGACACTAGTGGCACCAGC
AGTGACTTGGAGTCTGCAGAACTAGCTGAGAGACTCGATGAAATCAAAGATATCATGGAGCACCTGTATAAGCTC
TCCTTCAAGATACGCAACACGAGATATCGTTCTCTCACCAACAAAGCTCTTCTGATGAAAGAAGAGGATCCACAA
ACCGGGAAAGACTTGTTCTCGGCGTATGCCATCTTCGATTGTCGGCATGTACAAGAGTCACTCAATCGCTTGCGC
CTGCGTCCGTCATCAAAGGAATTCGTTACTGAACCTGCACGAAACCCAAGTGACGGGTGTTTCGATGTGTTAAAT
GGTGGGGATCGCCTGTTAAATAGCGACGATTTTCTACAAGATCGCTTAGCAAAAGCAATCACCAACCGCAGAAAG
TATTTTGCATATTGGCGGAGACATGCTCTCAAGCTCTCACACGTTACGGATGAGCTAGCCCCCCAACAAAATTTC
ACAACTCTCGTGAAGCCTGCGAGACCTGTTTCTGGACCTCCAACCACACCCTCAATCTCAGGGTGTTCCCTACCG
ACTCCAGGGGCAAAAACCCTGGTTTCAGGAACCGATTTCTCCTTGTATAGCCATGAATTGGACGACCAGCTGGAT
ACAGAGACCGTGTTTTCCTATGCGACAACAGCCTACGATGTTGACGGAAATTCCCCAGAACTACCTCCACCTCCT
CCCGATGCGGCCACGAAGCCAGAGTTTGTTTGTCAGTATTGCTGGGTGGCTTGTCCGTCGAGACAAGGAAAAGGA
AAGTCATGGCAAGAACATATCCGACAAGATCTCCAGCCGTACGTATGTACCTACGAGGAATGCTCAGATGCCGAC
CGCATGCACGCCAGTCGGCATGCGTGGCTTGAACATGAACGGCTAGTCCACCGCCGAATATGGAGATGCTTCGAA
CACAGGTCCTTCAGCTCCAAATCGAAAAACGGCTTGCTGCAACACTTTTTAGACTGCCACAAAGGTCTAGATGAG
CAGCAGATCGAAAACCTCCTGGATATAGCCGAGACGACGGTAGCCGATGACAGACAAACCTGCCCATTCTGCTTC
TCGATTGGACCTTTTGCTAAGGGGTTTCACAACCACGTGGCTTTCCACCAGGAACAATTCGCAACATTTGCAGTA
CCACGAAACTTTGACAGCAATAAAGAGGCGGACTCTAAAAAATCCGAAGGGATTAGATCAGCTGGATCTTTGTGT
TCCGTTGCTCTAGATTTCTCGGACGGTGATAGCAGCCTTGACAGCGACGACAGCGACGTATCAGTGAACCAACTC
GGAAACTCCCTGCTAAACTCTGCGAATTTCGGAGACGCTGCGGCTGTTAGGCTGCTACTCGAGAAGGGCGGTAAT
CCCGACTTAGGGGATAATAATGGCCAGACACCGCTATTATGGGCGGCTAAGAAAGGCCACGAGGCAGTCGTAAAG
CTACTACTCGAGAAGGGCGCCGATCCTGCCTTTAAGGATCATCGTGGCCAGACGCCGCTATCGTGGGCGGCTAAG
AAGGGCCACGAGGCAGTCGTAAAGCTGCTACTGGAGAAGGGCACCGATCCTTCCTTGGCGGATACTTATGGGCAG
ACGCCGCTATCGTGGGCCGCTAAGAAAGGCCACGAGGCAGTCGTAAAGCTACTACTGGAGAAGGGCACCGATCCT
TCCTTGGCGGATAATGATGGCCAGACACCGCTATTATGGGCGACTATAAATGGCCATAAGGCAGTCGTAAAGCTG
CTACTTGAGAAGGGTATCGATCCTACCTTAGCGGATACTTATAGCCAGACGCCGCTATCGTTAGCGGCTGAGACC
GGCCATGAGGCAGTTGTAAAGCGGCTACTTGACAATGGCGCCGATCCCGAGTCGATAGCGTGGGCGCCTAGGTCT
TCAGAATCAGATTCAGAATTAGACGATTCGGATCAAGGTTCTGTTATTCCCGACCGCCTCGCTTCAGAGGATTTT
ACCTAA
Gene >Pro_DTO377G3_2|g3532.t1
ATGGATGACATCGGCGTTCTTTCTACCTCTTGTCTAAGTTGCTTCGATACTCTGACACGATCGCTGCGCACATCT
TCGGATGAGTTCAAGAAACAGATGAGGCCAATAGCAATTGAAAATGAATATGCCCGCTTCAAGATTTGGGCTGGC
AACCTGGGCGCTTTACAGAGAGGCCGGCATTCTCTTGATGCTAGATTACGAGACTCGGTGGTGCTACGAGCAGCC
GTCCTCAAATTCATGGGAGAGTTACAAGACTCTTTGAGAAAGAGTACGTTGTGCCACACCTATGACACCTCCTAT
CATCTCTAGTTGGAACCCCTTATTGACTGTTATTGTCCAGGTGCCGAGATCACCACAGGTCTTCGCCTACCGTAC
GAACAGGGTGGCGATGCCACACATGGTCCCGACGAAGATGCTGAGGACAACAGTGACACTAGTGGCACCAGCAGT
GACTTGGAGTCTGCAGAACTAGCTGAGAGACTCGATGAAATCAAAGATATCATGGAGCACCTGTATAAGCTCTCC
TTCAAGATACGCAACACGAGATATCGTTCTCTCACCAACAAAGCTCTTCTGATGAAAGAAGAGGATCCACAAACC
GGGAAAGACTTGTTCTCGGCGTATGCCATCTTCGATTGTCGGCATGTACAAGAGTCACTCAATCGCTTGCGCCTG
CGTCCGTCATCAAAGGAATTCGTTACTGAACCTGCACGAAACCCAAGTGACGGGTGTTTCGATGTGTTAAATGGT
GGGGATCGCCTGTTAAATAGCGACGATTTTCTACAAGATCGCTTAGCAAAAGCAATCACCAACCGCAGAAAGTAT
TTTGCATATTGGCGGAGACATGCTCTCAAGCTCTCACACGTTACGGATGAGCTAGCCCCCCAACAAAATTTCACA
ACTCTCGTGAAGCCTGCGAGACCTGTTTCTGGACCTCCAACCACACCCTCAATCTCAGGGTGTTCCCTACCGACT
CCAGGGGCAAAAACCCTGGTTTCAGGAACCGATTTCTCCTTGTATAGCCATGAATTGGACGACCAGCTGGATACA
GAGACCGTGTTTTCCTATGCGACAACAGCCTACGATGTTGACGGAAATTCCCCAGAACTACCTCCACCTCCTCCC
GATGCGGCCACGAAGCCAGAGTTTGTTTGTCAGTATTGCTGGGTGGCTTGTCCGTCGAGACAAGGAAAAGGAAAG
TCATGGCAGTAAGTGTCTAAGATCATTGACAGGATAGGAGCATCGTTCTAATGAATGTTAGAGAACATATCCGAC
AAGATCTCCAGCCGTACGTATGTACCTACGAGGAATGCTCAGATGCCGACCGCATGCACGCCAGTCGGCATGCGT
GGCTTGAACATGAACGGCTAGTCCACCGCCGAATATGGAGATGCTTCGAACACAGGTCCTTCAGCTCCAAATCGA
AAAACGGCTTGCTGCAACACTTTTTAGACTGCCACAAAGGTCTAGATGAGCAGCAGATCGAAAACCTCCTGGATA
TAGCCGAGACGACGGTAGCCGATGACAGACAAACCTGCCCATTCTGCTTCTCGATTGGACCTTTTGCTAAGGGGT
TTCACAACCACGTGGCTTTCCACCAGGAACAATTCGCAACATTTGCAGTACCACGAAACTTTGACAGCAATAAAG
AGGCGGACTCTAAAAAATCCGAAGGGATTAGATCAGCTGGATCTTTGTGTTCCGTTGCTCTAGATTTCTCGGACG
GTGATAGCAGCCTTGACAGCGACGACAGCGACGTATCAGTGAACCAACTCGGAAACTCCCTGCTAAACTCTGCGA
ATTTCGGAGACGCTGCGGCTGTTAGGCTGCTACTCGAGAAGGGCGGTAATCCCGACTTAGGGGATAATAATGGCC
AGACACCGCTATTATGGGCGGCTAAGAAAGGCCACGAGGCAGTCGTAAAGCTACTACTCGAGAAGGGCGCCGATC
CTGCCTTTAAGGATCATCGTGGCCAGACGCCGCTATCGTGGGCGGCTAAGAAGGGCCACGAGGCAGTCGTAAAGC
TGCTACTGGAGAAGGGCACCGATCCTTCCTTGGCGGATACTTATGGGCAGACGCCGCTATCGTGGGCCGCTAAGA
AAGGCCACGAGGCAGTCGTAAAGCTACTACTGGAGAAGGGCACCGATCCTTCCTTGGCGGATAATGATGGCCAGA
CACCGCTATTATGGGCGACTATAAATGGCCATAAGGCAGTCGTAAAGCTGCTACTTGAGAAGGGTATCGATCCTA
CCTTAGCGGATACTTATAGCCAGACGCCGCTATCGTTAGCGGCTGAGACCGGCCATGAGGCAGTTGTAAAGCGGC
TACTTGACAATGGCGCCGATCCCGAGTCGATAGCGTGGGCGCCTAGGTCTTCAGAATCAGATTCAGAATTAGACG
ATTCGGATCAAGGTTCTGTTATTCCCGACCGCCTCGCTTCAGAGGATTTTACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail