Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3531.t1
Gene name
Locationscaffold_06:27018..29904
Strand-
Gene length (bp)2886
Transcript length (bp)2508
Coding sequence length (bp)2508
Protein length (aa) 836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19343 DUF5923 Family of unknown function (DUF5923) 4.3E-82 2 220
PF19343 DUF5923 Family of unknown function (DUF5923) 7.2E-166 229 576
PF14613 DUF4449 Protein of unknown function (DUF4449) 3.1E-61 589 748

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3531.t1
MSVNVPTNPKQKEKDINQKLQFFGIYHAFKNSKLPSNKQCDIALNSVLNSKALKSPPKELSRDGKVLVADLRNVI
DAAKNMLLVKNEGNLLQDFVWQAQRMSTGNADANRPGLPIDKEAGQQDASKAIDGLKTLGTLMITNGEFRKLLSD
AMTLGKDIAADASQKAANQVRPSQDELSQIDQPAEDNVWHEKPNVSKDDLKSKFKKNKADKGSAASASAGVAEEE
TGVSPQSKKRELSDRTKAYLSEKVPKERREQTIWRLKKMIIEIQGHEDYQQAVETLLNMAEQYAGHTRDLSKEGS
SSARDVLKSDDVQAVQYNLRTLIERFANHTSLDGFFESLNAIYREAEKDPELRNWFKNVSNLIRKSLREQGFIME
EECNRQWNDLYDKGRYLLRERYRGYSDRIVDEVKFLGDQFEQDVQNQALAESFQKLFKDLGHDSSGRPTFKPDLL
RDLRDVIIPQFFENVRYVPIPRIEVADPMVDVVIENLCLEGDNLMPNVMEFGSDNYFRWGRKKISNKSDNKIMIS
MSGIQMDLRDVGYYIKKKEGFPTITDRGIMDIFLGGDGLSVKLAASTAQPSDKEHFFKLDRVDVTIRNMDIKLKK
SSHKLLFYTFKPMLFRVVRPALQKVVEAQIREAFKKGDLFAKDVHTEATRAQEAAREDPENAPSIFSRYADAIRA
RMQAKAQQAKSAAQRDTQVQTVMTLHDSLFPGIELPGAVSTKATEYADLAAKGARWESPIFSIGSAAESRGIPSG
GPITRKTARPASSSGGNAAATSNAGNVTNGNRVSGSQPRGGFSDEVDKAFVNGKPHTLGDSFKHGADGVTNTTVT
NGANNFATAV*
Coding >Pro_DTO377G3_2|g3531.t1
ATGTCTGTGAACGTTCCCACAAATCCTAAACAGAAGGAGAAGGATATCAACCAGAAGCTTCAATTCTTTGGTATC
TACCATGCCTTCAAGAATAGCAAGCTCCCCTCGAACAAGCAATGCGACATTGCTTTGAACAGTGTCTTGAACTCC
AAGGCCCTCAAATCTCCACCAAAGGAGCTCTCACGCGATGGAAAGGTCCTTGTGGCAGATCTGCGCAATGTCATC
GACGCAGCGAAGAATATGCTCTTGGTCAAGAACGAGGGTAACCTCCTGCAAGACTTTGTCTGGCAAGCCCAGAGG
ATGTCCACTGGCAATGCGGATGCCAATCGCCCTGGGCTCCCCATCGACAAGGAAGCCGGTCAGCAAGATGCTAGC
AAGGCCATTGATGGCCTCAAGACCCTGGGCACGCTCATGATCACCAACGGAGAGTTTAGAAAACTACTGAGCGAC
GCCATGACACTGGGCAAAGACATTGCGGCCGATGCTTCTCAAAAGGCCGCCAACCAGGTTCGCCCTTCGCAGGAT
GAGCTTTCGCAGATCGACCAACCTGCAGAGGACAACGTGTGGCACGAGAAACCCAATGTCTCCAAGGATGACCTA
AAGTCCAAATTTAAGAAGAACAAGGCTGATAAGGGAAGCGCTGCTTCCGCTTCCGCTGGGGTTGCCGAGGAAGAG
ACTGGCGTGTCGCCGCAGAGCAAGAAGAGGGAATTATCCGACAGGACCAAGGCTTACTTGTCCGAGAAAGTTCCC
AAGGAGCGTCGCGAGCAGACCATCTGGCGCCTGAAGAAGATGATCATTGAAATCCAGGGTCATGAAGACTACCAG
CAAGCCGTTGAGACCCTATTGAACATGGCTGAGCAATACGCCGGACACACCAGAGACCTTTCCAAGGAGGGCAGT
AGCTCTGCCCGTGACGTCCTGAAGAGCGACGATGTTCAGGCTGTTCAGTACAATTTGCGCACTCTTATCGAACGC
TTTGCCAACCACACCTCTCTAGACGGCTTCTTCGAATCGCTCAACGCCATTTACCGTGAGGCTGAGAAGGACCCC
GAACTCCGAAACTGGTTCAAGAACGTCAGCAACTTGATTCGCAAATCTCTGCGCGAACAGGGCTTCATCATGGAA
GAGGAATGCAACCGCCAGTGGAACGATCTTTACGACAAGGGCCGTTACCTCCTGCGCGAGCGTTACCGCGGTTAC
TCCGACCGCATTGTCGACGAGGTCAAGTTCTTGGGTGACCAATTTGAGCAGGACGTGCAAAACCAGGCCCTTGCC
GAGTCGTTCCAGAAGCTATTCAAGGATCTGGGCCACGATTCCAGTGGCAGGCCTACCTTTAAGCCGGATCTTCTT
CGGGATCTCCGCGATGTCATCATTCCGCAATTTTTCGAGAACGTCCGCTATGTTCCAATCCCCCGTATTGAAGTA
GCGGATCCCATGGTTGATGTTGTAATCGAGAACCTGTGCCTCGAGGGCGACAACTTGATGCCCAACGTTATGGAG
TTCGGCAGCGACAACTACTTCCGCTGGGGCCGCAAGAAGATCTCCAACAAGAGTGATAATAAGATCATGATTTCC
ATGTCTGGTATCCAGATGGATCTGCGCGATGTTGGATACTACATCAAGAAGAAGGAGGGCTTCCCCACCATCACC
GATCGCGGTATTATGGACATCTTCCTCGGCGGCGACGGTCTCAGCGTGAAACTCGCTGCCTCTACCGCCCAGCCG
AGCGACAAGGAGCACTTCTTCAAGCTTGACAGAGTGGATGTGACCATCAGGAACATGGATATCAAGCTGAAGAAG
TCCAGCCACAAGCTGCTCTTTTACACCTTCAAGCCCATGCTGTTCCGCGTCGTCAGGCCTGCTCTGCAGAAGGTC
GTCGAGGCCCAGATCCGCGAAGCCTTCAAGAAGGGTGACCTCTTTGCCAAGGACGTCCACACCGAGGCGACGCGT
GCCCAGGAAGCCGCCCGTGAAGACCCCGAGAATGCGCCGTCCATCTTCTCCCGCTACGCCGATGCCATCCGAGCT
CGCATGCAAGCCAAGGCCCAACAGGCCAAGAGCGCCGCCCAGCGTGATACCCAGGTCCAAACCGTCATGACCCTC
CACGATTCCCTGTTCCCTGGAATCGAGCTTCCCGGCGCTGTATCCACCAAGGCCACCGAGTACGCCGACCTGGCT
GCCAAGGGCGCGCGCTGGGAGTCCCCCATCTTCAGCATCGGAAGCGCAGCCGAGTCCAGAGGCATCCCATCCGGC
GGGCCCATCACCAGGAAGACTGCCCGCCCTGCTAGCAGCAGCGGTGGAAATGCCGCCGCTACTTCGAACGCTGGC
AACGTCACTAACGGCAACAGGGTCTCCGGATCCCAGCCCCGTGGCGGCTTCTCCGATGAGGTTGATAAGGCTTTC
GTCAATGGCAAGCCTCATACCTTGGGTGATTCCTTCAAGCATGGCGCTGATGGTGTCACTAATACTACCGTGACT
AACGGAGCTAACAATTTTGCAACCGCTGTCTAA
Transcript >Pro_DTO377G3_2|g3531.t1
ATGTCTGTGAACGTTCCCACAAATCCTAAACAGAAGGAGAAGGATATCAACCAGAAGCTTCAATTCTTTGGTATC
TACCATGCCTTCAAGAATAGCAAGCTCCCCTCGAACAAGCAATGCGACATTGCTTTGAACAGTGTCTTGAACTCC
AAGGCCCTCAAATCTCCACCAAAGGAGCTCTCACGCGATGGAAAGGTCCTTGTGGCAGATCTGCGCAATGTCATC
GACGCAGCGAAGAATATGCTCTTGGTCAAGAACGAGGGTAACCTCCTGCAAGACTTTGTCTGGCAAGCCCAGAGG
ATGTCCACTGGCAATGCGGATGCCAATCGCCCTGGGCTCCCCATCGACAAGGAAGCCGGTCAGCAAGATGCTAGC
AAGGCCATTGATGGCCTCAAGACCCTGGGCACGCTCATGATCACCAACGGAGAGTTTAGAAAACTACTGAGCGAC
GCCATGACACTGGGCAAAGACATTGCGGCCGATGCTTCTCAAAAGGCCGCCAACCAGGTTCGCCCTTCGCAGGAT
GAGCTTTCGCAGATCGACCAACCTGCAGAGGACAACGTGTGGCACGAGAAACCCAATGTCTCCAAGGATGACCTA
AAGTCCAAATTTAAGAAGAACAAGGCTGATAAGGGAAGCGCTGCTTCCGCTTCCGCTGGGGTTGCCGAGGAAGAG
ACTGGCGTGTCGCCGCAGAGCAAGAAGAGGGAATTATCCGACAGGACCAAGGCTTACTTGTCCGAGAAAGTTCCC
AAGGAGCGTCGCGAGCAGACCATCTGGCGCCTGAAGAAGATGATCATTGAAATCCAGGGTCATGAAGACTACCAG
CAAGCCGTTGAGACCCTATTGAACATGGCTGAGCAATACGCCGGACACACCAGAGACCTTTCCAAGGAGGGCAGT
AGCTCTGCCCGTGACGTCCTGAAGAGCGACGATGTTCAGGCTGTTCAGTACAATTTGCGCACTCTTATCGAACGC
TTTGCCAACCACACCTCTCTAGACGGCTTCTTCGAATCGCTCAACGCCATTTACCGTGAGGCTGAGAAGGACCCC
GAACTCCGAAACTGGTTCAAGAACGTCAGCAACTTGATTCGCAAATCTCTGCGCGAACAGGGCTTCATCATGGAA
GAGGAATGCAACCGCCAGTGGAACGATCTTTACGACAAGGGCCGTTACCTCCTGCGCGAGCGTTACCGCGGTTAC
TCCGACCGCATTGTCGACGAGGTCAAGTTCTTGGGTGACCAATTTGAGCAGGACGTGCAAAACCAGGCCCTTGCC
GAGTCGTTCCAGAAGCTATTCAAGGATCTGGGCCACGATTCCAGTGGCAGGCCTACCTTTAAGCCGGATCTTCTT
CGGGATCTCCGCGATGTCATCATTCCGCAATTTTTCGAGAACGTCCGCTATGTTCCAATCCCCCGTATTGAAGTA
GCGGATCCCATGGTTGATGTTGTAATCGAGAACCTGTGCCTCGAGGGCGACAACTTGATGCCCAACGTTATGGAG
TTCGGCAGCGACAACTACTTCCGCTGGGGCCGCAAGAAGATCTCCAACAAGAGTGATAATAAGATCATGATTTCC
ATGTCTGGTATCCAGATGGATCTGCGCGATGTTGGATACTACATCAAGAAGAAGGAGGGCTTCCCCACCATCACC
GATCGCGGTATTATGGACATCTTCCTCGGCGGCGACGGTCTCAGCGTGAAACTCGCTGCCTCTACCGCCCAGCCG
AGCGACAAGGAGCACTTCTTCAAGCTTGACAGAGTGGATGTGACCATCAGGAACATGGATATCAAGCTGAAGAAG
TCCAGCCACAAGCTGCTCTTTTACACCTTCAAGCCCATGCTGTTCCGCGTCGTCAGGCCTGCTCTGCAGAAGGTC
GTCGAGGCCCAGATCCGCGAAGCCTTCAAGAAGGGTGACCTCTTTGCCAAGGACGTCCACACCGAGGCGACGCGT
GCCCAGGAAGCCGCCCGTGAAGACCCCGAGAATGCGCCGTCCATCTTCTCCCGCTACGCCGATGCCATCCGAGCT
CGCATGCAAGCCAAGGCCCAACAGGCCAAGAGCGCCGCCCAGCGTGATACCCAGGTCCAAACCGTCATGACCCTC
CACGATTCCCTGTTCCCTGGAATCGAGCTTCCCGGCGCTGTATCCACCAAGGCCACCGAGTACGCCGACCTGGCT
GCCAAGGGCGCGCGCTGGGAGTCCCCCATCTTCAGCATCGGAAGCGCAGCCGAGTCCAGAGGCATCCCATCCGGC
GGGCCCATCACCAGGAAGACTGCCCGCCCTGCTAGCAGCAGCGGTGGAAATGCCGCCGCTACTTCGAACGCTGGC
AACGTCACTAACGGCAACAGGGTCTCCGGATCCCAGCCCCGTGGCGGCTTCTCCGATGAGGTTGATAAGGCTTTC
GTCAATGGCAAGCCTCATACCTTGGGTGATTCCTTCAAGCATGGCGCTGATGGTGTCACTAATACTACCGTGACT
AACGGAGCTAACAATTTTGCAACCGCTGTCTAA
Gene >Pro_DTO377G3_2|g3531.t1
ATGTCTGTGAACGTTCCCACAAATCCTAAACAGAAGGAGAAGGTATGGATGACAATGCGACTCCATTGAAACCAC
ACTGACAGAGAATCTCCAGGATATCAACCAGAAGCTTCAATTCTTTGGTATCTACCATGGTAAGTCCAGCTTCAC
ATCCTCCAATTGACCATTCCTGTACTAACTGTGTCTGCTATAGCCTTCAAGAATAGCAAGCTCCCCTCGGTCCGT
CTCAATCTCCTACCGCCAATGGCCTTGTCACAAATGCTAACTAGGTCTCCTCCCACAGAACAAGCAATGCGACAT
TGCTTTGAACAGTGTCTTGAACTCCAAGGCCCTCAAATCTCCACCAAAGGAGCTCTCACGCGATGGAAAGGTCCT
TGTGGCAGATCTGCGCAATGTCATCGACGCAGCGAAGAATATGCTCTTGGTCAAGAACGAGGGTAACCTCCTGCA
AGACTTTGTCTGGCAAGCCCAGAGGATGTCCACTGGCAATGCGGATGCCAATCGCCCTGGGCTCCCCATCGACAA
GGAAGCCGGTCAGCAAGATGCTAGCAAGGCCATTGATGGCCTCAAGACCCTGGGCACGCTCATGATCACCAACGG
AGAGTTTAGAAAACTACGTAAGTGAACTTCCGTTCGCGAATCACGGGCATTCCTAACAACGCGCAGTGAGCGACG
CCATGACACTGGGCAAAGACATTGCGGCCGATGCTTCTCAAAAGGCCGCCAACCAGGTTCGCCCTTCGCAGGATG
AGCTTTCGCAGATCGACCAACCTGCAGAGGACAACGTGTGGCACGAGAAACCCAATGTCTCCAAGGATGACCTAA
AGTCCAAATTTAAGAAGAACAAGGCTGTATGTATTCCTAGTGCGCTATAATTCGGCACATACTGACACTTAGCTC
AGGATAAGGGAAGCGCTGCTTCCGCTTCCGCTGGGGTTGCCGAGGAAGAGACTGGCGTGTCGCCGCAGAGCAAGA
AGAGGGAATTATCCGACAGGACCAAGGCTTACTTGTCCGAGAAAGTTCCCAAGGAGCGTCGCGAGCAGACCATCT
GGCGCCTGAAGAAGATGATCATTGAAATCCAGGGTCATGAAGACTGTAAGTCACCCACAATCTATATCGACGGCA
AAGATTTACTAACAAATTATGCAGACCAGCAAGCCGTTGAGACCCTATTGAACATGGCTGAGCAATACGCCGGAC
ACACCAGAGACCTTTCCAAGGAGGGCAGTAGCTCTGCCCGTGACGTCCTGAAGAGCGACGATGTTCAGGCTGTTC
AGTACAATTTGCGCACTCTTATCGAACGCTTTGCCAACCACACCTCTCTAGACGGCTTCTTCGAATCGCTCAACG
CCATTTACCGTGAGGCTGAGAAGGACCCCGAACTCCGAAACTGGTTCAAGAACGTCAGCAACTTGATTCGGTATG
TGAATTAGATGATTTTCCCCAGGATAAAAGCTGACCGGACATAGCAAATCTCTGCGCGAACAGGGCTTCATCATG
GAAGAGGAATGCAACCGCCAGTGGAACGATCTTTACGACAAGGGCCGTTACCTCCTGCGCGAGCGTTACCGCGGT
TACTCCGACCGCATTGTCGACGAGGTCAAGTTCTTGGGTGACCAATTTGAGCAGGACGTGCAAAACCAGGCCCTT
GCCGAGTCGTTCCAGAAGCTATTCAAGGATCTGGGCCACGATTCCAGTGGCAGGCCTACCTTTAAGCCGGATCTT
CTTCGGGATCTCCGCGATGTCATCATTCCGCAATTTTTCGAGAACGTCCGCTATGTTCCAATCCCCCGTATTGAA
GTAGCGGATCCCATGGTTGATGTTGTAATCGAGAACCTGTGCCTCGAGGGCGACAACTTGATGCCCAACGTTATG
GAGTTCGGCAGCGACAACTACTTCCGCTGGGGCCGCAAGAAGATCTCCAACAAGAGTGATAATAAGATCATGATT
TCCATGTCTGGTATCCAGATGGATCTGCGCGATGTTGGATACTACATCAAGAAGAAGGAGGGCTTCCCCACCATC
ACCGATCGCGGTATTATGGACATCTTCCTCGGCGGCGACGGTCTCAGCGTGAAACTCGCTGCCTCTACCGCCCAG
CCGAGCGACAAGGAGCACTTCTTCAAGCTTGACAGAGTGGATGTGACCATCAGGAACATGGATATCAAGCTGAAG
AAGTCCAGCCACAAGCTGCTCTTTTACACCTTCAAGCCCATGCTGTTCCGCGTCGTCAGGCCTGCTCTGCAGAAG
GTCGTCGAGGCCCAGATCCGCGAAGCCTTCAAGAAGGGTGACCTCTTTGCCAAGGACGTCCACACCGAGGCGACG
CGTGCCCAGGAAGCCGCCCGTGAAGACCCCGAGAATGCGCCGTCCATCTTCTCCCGCTACGCCGATGCCATCCGA
GCTCGCATGCAAGCCAAGGCCCAACAGGCCAAGAGCGCCGCCCAGCGTGATACCCAGGTCCAAACCGTCATGACC
CTCCACGATTCCCTGTTCCCTGGAATCGAGCTTCCCGGCGCTGTATCCACCAAGGCCACCGAGTACGCCGACCTG
GCTGCCAAGGGCGCGCGCTGGGAGTCCCCCATCTTCAGCATCGGAAGCGCAGCCGAGTCCAGAGGCATCCCATCC
GGCGGGCCCATCACCAGGAAGACTGCCCGCCCTGCTAGCAGCAGCGGTGGAAATGCCGCCGCTACTTCGAACGCT
GGCAACGTCACTAACGGCAACAGGGTCTCCGGATCCCAGCCCCGTGGCGGCTTCTCCGATGAGGTTGATAAGGCT
TTCGTCAATGGCAAGCCTCATACCTTGGGTGATTCCTTCAAGCATGGCGCTGATGGTGTCACTAATACTACCGTG
ACTAACGGAGCTAACAATTTTGCAACCGCTGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail