Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3530.t1
Gene name
Locationscaffold_06:24747..26641
Strand+
Gene length (bp)1894
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00731 AIRC AIR carboxylase 4.3E-58 404 549
PF02222 ATP-grasp ATP-grasp domain 5.5E-51 112 283
PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain 5.0E-18 311 368
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 1.7E-05 106 275
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 8.9E-05 117 268

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0006189 'de novo' IMP biosynthetic process Yes
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0032553 ribonucleotide binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0009167 purine ribonucleoside monophosphate metabolic process No
GO:0003824 catalytic activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0090407 organophosphate biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0009123 nucleoside monophosphate metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:1901363 heterocyclic compound binding No
GO:0009124 nucleoside monophosphate biosynthetic process No
GO:0009168 purine ribonucleoside monophosphate biosynthetic process No
GO:0009156 ribonucleoside monophosphate biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0046040 IMP metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0006188 IMP biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0009126 purine nucleoside monophosphate metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0046390 ribose phosphate biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0009127 purine nucleoside monophosphate biosynthetic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901576 organic substance biosynthetic process No
GO:0006163 purine nucleotide metabolic process No
GO:0009161 ribonucleoside monophosphate metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0019438 aromatic compound biosynthetic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005488 binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0036094 small molecule binding No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0018130 heterocycle biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0016881 acid-amino acid ligase activity No
GO:0030554 adenyl nucleotide binding No
GO:0006753 nucleoside phosphate metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0016874 ligase activity No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0008144 drug binding No
GO:0009150 purine ribonucleotide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3530.t1
MWNSPKVGILGGGQLGRMLVESANRLNIQVNILDVDNSPAKQISSHDGHVTGSFKEPDAVRKLAETCDVITAEIE
HVDTYALEEVASKVRVEPSWQAIRTIQNKFNQKEHLRKYGIPMADHRELVDNTPEELAQIGEQLGYPMMLKSKTM
AYDGRGNFRVNSKEDIPEALEALKDRPLYSEKWAYFKMELAVMVIKTKDDVLSYPTVETVQEDSICKLVYAPARN
VPEAINQQAQALARKAVSAFEGKGAFGVEMFLLEDNSLMLCELASRIHNSGHWTIEGCALSQFDSHIRAILDLPI
PPKSLELRQPSIMLNIIGGATPDSHLKATEAALSIPNASIHLYSKGAARPGRKMGHVTVTAATMHEAETLIQPLI
DVVDTMRAQRSDIKTKAAPSGPSKPVPSVAVIMGSDSDLKTLVPGLKLLRDYFGIEPEVEITSAHRTPDYMAEYA
GQAASRGIKVIIAAAGGAAHLPGMAAAHTALPVIGVPVKGSSLDGVDSLYSIVQMPRGVPVATVGINNSINAALL
AARVLGSFDPAIQRKVEAYAEAARAENMELKGTKLRELGWQKYFDQM*
Coding >Pro_DTO377G3_2|g3530.t1
ATGTGGAACTCGCCTAAGGTCGGAATCCTTGGCGGCGGCCAACTGGGCCGCATGCTCGTCGAGTCGGCCAACCGA
TTGAACATTCAGGTCAATATCCTGGACGTCGATAACTCTCCTGCCAAGCAGATCAGTTCGCACGACGGCCATGTG
ACCGGCTCCTTTAAGGAGCCTGATGCCGTGCGTAAACTGGCTGAGACTTGCGATGTCATCACTGCTGAGATTGAG
CACGTCGACACCTACGCTCTCGAGGAGGTTGCATCGAAGGTGCGGGTGGAACCCAGCTGGCAGGCTATCCGGACA
ATCCAGAACAAGTTCAACCAGAAGGAGCACCTCCGCAAATATGGTATCCCTATGGCCGACCACCGGGAGCTGGTG
GACAACACACCCGAGGAATTGGCTCAGATTGGAGAGCAATTGGGCTACCCGATGATGTTGAAGTCGAAGACTATG
GCATATGACGGACGTGGAAACTTCCGTGTCAATTCCAAAGAAGATATTCCCGAGGCCCTAGAGGCTCTCAAGGAC
CGCCCGCTCTACTCGGAAAAATGGGCTTACTTCAAGATGGAACTCGCCGTCATGGTTATCAAGACTAAGGACGAC
GTCCTCTCTTACCCCACCGTCGAGACCGTCCAAGAGGACTCAATATGCAAGCTGGTGTATGCGCCAGCCCGCAAC
GTCCCCGAAGCCATCAACCAGCAAGCGCAAGCTCTCGCTCGTAAAGCCGTCTCTGCCTTCGAAGGCAAAGGCGCC
TTCGGCGTGGAGATGTTCCTCCTAGAAGACAACAGCCTCATGCTCTGCGAGCTTGCAAGCCGAATCCACAACTCC
GGGCACTGGACAATCGAAGGCTGCGCGCTATCCCAATTCGACAGCCACATCCGCGCGATCCTCGACCTGCCCATC
CCGCCCAAGAGCCTTGAGCTTCGCCAGCCCTCCATCATGCTCAACATCATCGGCGGCGCAACTCCCGACTCCCAC
CTCAAGGCCACCGAAGCGGCCCTCTCCATCCCCAACGCCAGCATCCACCTCTACAGCAAGGGCGCCGCAAGGCCT
GGCCGCAAAATGGGCCACGTCACCGTCACCGCCGCGACTATGCACGAAGCCGAGACCTTGATCCAGCCCCTCATC
GACGTCGTCGATACCATGCGCGCCCAGCGCTCCGATATCAAAACCAAGGCTGCCCCCTCCGGTCCCTCCAAGCCC
GTCCCCTCTGTCGCCGTCATCATGGGCTCCGACAGCGACCTGAAGACCCTCGTCCCAGGCCTCAAGCTGCTGCGT
GATTACTTCGGCATCGAGCCTGAGGTTGAGATTACCTCTGCTCACCGCACGCCCGATTACATGGCCGAGTATGCG
GGCCAGGCTGCCTCGCGCGGCATCAAGGTGATCATCGCAGCCGCCGGTGGTGCTGCCCACCTTCCCGGTATGGCA
GCTGCTCACACTGCCCTCCCTGTCATCGGCGTGCCGGTTAAGGGGAGCTCACTCGACGGTGTCGACAGTCTGTAC
AGCATTGTGCAGATGCCTCGAGGCGTCCCCGTCGCCACTGTCGGCATCAACAACAGCATCAACGCTGCCCTCCTC
GCCGCGCGTGTGCTTGGCTCTTTCGACCCGGCTATTCAGCGCAAGGTCGAGGCGTATGCCGAGGCTGCCCGTGCC
GAGAACATGGAGTTGAAGGGTACCAAGTTGCGCGAGTTGGGGTGGCAGAAGTACTTTGATCAGATGTAG
Transcript >Pro_DTO377G3_2|g3530.t1
ATGTGGAACTCGCCTAAGGTCGGAATCCTTGGCGGCGGCCAACTGGGCCGCATGCTCGTCGAGTCGGCCAACCGA
TTGAACATTCAGGTCAATATCCTGGACGTCGATAACTCTCCTGCCAAGCAGATCAGTTCGCACGACGGCCATGTG
ACCGGCTCCTTTAAGGAGCCTGATGCCGTGCGTAAACTGGCTGAGACTTGCGATGTCATCACTGCTGAGATTGAG
CACGTCGACACCTACGCTCTCGAGGAGGTTGCATCGAAGGTGCGGGTGGAACCCAGCTGGCAGGCTATCCGGACA
ATCCAGAACAAGTTCAACCAGAAGGAGCACCTCCGCAAATATGGTATCCCTATGGCCGACCACCGGGAGCTGGTG
GACAACACACCCGAGGAATTGGCTCAGATTGGAGAGCAATTGGGCTACCCGATGATGTTGAAGTCGAAGACTATG
GCATATGACGGACGTGGAAACTTCCGTGTCAATTCCAAAGAAGATATTCCCGAGGCCCTAGAGGCTCTCAAGGAC
CGCCCGCTCTACTCGGAAAAATGGGCTTACTTCAAGATGGAACTCGCCGTCATGGTTATCAAGACTAAGGACGAC
GTCCTCTCTTACCCCACCGTCGAGACCGTCCAAGAGGACTCAATATGCAAGCTGGTGTATGCGCCAGCCCGCAAC
GTCCCCGAAGCCATCAACCAGCAAGCGCAAGCTCTCGCTCGTAAAGCCGTCTCTGCCTTCGAAGGCAAAGGCGCC
TTCGGCGTGGAGATGTTCCTCCTAGAAGACAACAGCCTCATGCTCTGCGAGCTTGCAAGCCGAATCCACAACTCC
GGGCACTGGACAATCGAAGGCTGCGCGCTATCCCAATTCGACAGCCACATCCGCGCGATCCTCGACCTGCCCATC
CCGCCCAAGAGCCTTGAGCTTCGCCAGCCCTCCATCATGCTCAACATCATCGGCGGCGCAACTCCCGACTCCCAC
CTCAAGGCCACCGAAGCGGCCCTCTCCATCCCCAACGCCAGCATCCACCTCTACAGCAAGGGCGCCGCAAGGCCT
GGCCGCAAAATGGGCCACGTCACCGTCACCGCCGCGACTATGCACGAAGCCGAGACCTTGATCCAGCCCCTCATC
GACGTCGTCGATACCATGCGCGCCCAGCGCTCCGATATCAAAACCAAGGCTGCCCCCTCCGGTCCCTCCAAGCCC
GTCCCCTCTGTCGCCGTCATCATGGGCTCCGACAGCGACCTGAAGACCCTCGTCCCAGGCCTCAAGCTGCTGCGT
GATTACTTCGGCATCGAGCCTGAGGTTGAGATTACCTCTGCTCACCGCACGCCCGATTACATGGCCGAGTATGCG
GGCCAGGCTGCCTCGCGCGGCATCAAGGTGATCATCGCAGCCGCCGGTGGTGCTGCCCACCTTCCCGGTATGGCA
GCTGCTCACACTGCCCTCCCTGTCATCGGCGTGCCGGTTAAGGGGAGCTCACTCGACGGTGTCGACAGTCTGTAC
AGCATTGTGCAGATGCCTCGAGGCGTCCCCGTCGCCACTGTCGGCATCAACAACAGCATCAACGCTGCCCTCCTC
GCCGCGCGTGTGCTTGGCTCTTTCGACCCGGCTATTCAGCGCAAGGTCGAGGCGTATGCCGAGGCTGCCCGTGCC
GAGAACATGGAGTTGAAGGGTACCAAGTTGCGCGAGTTGGGGTGGCAGAAGTACTTTGATCAGATGTAG
Gene >Pro_DTO377G3_2|g3530.t1
ATGTGGAACTCGCCTAAGGTCGGAATCCTTGGCGGCGGCCAACTGGGCCGCATGCTCGTCGAGTCGGCCAACCGA
TTGAACATTCAGGTCAATATCCTGGACGTCGATAACTCTCCTGCCAAGCAGATCAGTTCGCACGACGGCCATGTG
ACCGGCTCCTTTAAGGAGCCTGATGCCGTGCGTAAACTGGCTGAGACTTGCGATGTCATCACTGCTGAGATTGAG
CACGTCGACACCTACGCTCTCGAGGAGGTTGCATCGAAGGTGCGGGTGGAACCCAGCTGGCAGGCTATCCGGACA
ATCCAGAACAAGTTCAACCAGAAGGAGCACCTCCGCAAATATGGTATCCCTATGGCCGACCACCGGGAGCTGGTG
GACAACACACCCGAGGAATTGGCTCAGATTGGAGAGCAATTGGGCTACCCGATGATGTTGAAGTCGAAGACTATG
GCATATGACGGACGTGGTGAGTCATATGTGATGCCGAAGGGTATACATTTTGTTGACAGTATCAAGGAAACTTCC
GTGTCAATTCCAAAGAAGATATTCCCGAGGCCCTAGAGGCTCTCAAGGACCGCCCGCTCTACTCGGAAAAATGGG
CTTACTTCAAGATGGTTAGTAGCAGTTGAATACCACGCCATGCATGTCTAATAATTTGTACAGGAACTCGCCGTC
ATGGTTATCAAGACTAAGGACGACGTCCTCTCTTACCCCACCGTCGAGACCGTCCAAGAGGACTCAATATGCAAG
CTGGTGTATGCGCCAGCCCGCAACGTCCCCGAAGCCATCAACCAGCAAGCGCAAGCTCTCGCTCGTAAAGCCGTC
TCTGCCTTCGAAGGCAAAGGCGCCTTCGGCGTGGAGATGTTCCTCCTAGAAGACAACAGCCTCATGCTCTGCGAG
CTTGCAAGCCGAATCCACAACTCCGGGCACTGGACAATCGAAGGCTGCGCGCTATCCCAATTCGACAGCCACATC
CGCGCGATCCTCGACCTGCCCATCCCGCCCAAGAGCCTTGAGCTTCGCCAGCCCTCCATCATGCTCAACATCATC
GGCGGCGCAACTCCCGACTCCCACCTCAAGGCCACCGAAGCGGCCCTCTCCATCCCCAACGCCAGCATCCACCTC
TACAGCAAGGGCGCCGCAAGGCCTGGCCGCAAAATGGGCCACGTCACCGTCACCGCCGCGACTATGCACGAAGCC
GAGACCTTGATCCAGCCCCTCATCGACGTCGTCGATACCATGCGCGCCCAGCGCTCCGATATCAAAACCAAGGCT
GCCCCCTCCGGTCCCTCCAAGCCCGTCCCCTCTGTCGCCGTCATCATGGGCTCCGACAGCGACCTGAAGACCCTC
GTCCCAGGCCTCAAGCTGCTGCGTGATTACTTCGGCATCGAGCCTGAGGTTGAGATTACCTCTGCTCACCGCACG
CCCGATTACATGGCCGAGTATGCGGGCCAGGCTGCCTCGCGCGGCATCAAGGTGATCATCGCAGCCGCCGGTGGT
GCTGCCCACCTTCCCGGTATGGCAGCTGCTCACACTGCCCTCCCTGTCATCGGCGTGCCGGTTAAGGGGAGCTCA
CTCGACGGTGTCGACAGTCTGTACAGCATTGTGCAGATGCCTCGAGGTACGTTATTTCCCACTTTACTCTCCTTT
TACACCCATTTACTTTGACCCGATCTATATCTAACATTTCATAATAGGCGTCCCCGTCGCCACTGTCGGCATCAA
CAACAGCATCAACGCTGCCCTCCTCGCCGCGCGTGTGCTTGGCTCTTTCGACCCGGCTATTCAGCGCAAGGTCGA
GGCGTATGCCGAGGCTGCCCGTGCCGAGAACATGGAGTTGAAGGGTACCAAGTTGCGCGAGTTGGGGTGGCAGAA
GTACTTTGATCAGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail