Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g351.t1
Gene name
Locationscaffold_01:886280..887411
Strand+
Gene length (bp)1131
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04757 Pex2_Pex12 Pex2 / Pex12 amino terminal region 3.1E-46 40 261
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.1E-11 324 362
PF13639 zf-RING_2 Ring finger domain 1.3E-09 324 363
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 8.7E-10 322 366
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 9.7E-10 325 362
PF13445 zf-RING_UBOX RING-type zinc-finger 6.9E-08 325 360
PF14634 zf-RING_5 zinc-RING finger domain 1.3E-06 324 364
PF14447 Prok-RING_4 Prokaryotic RING finger family 4 2.6E-06 325 366

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 194 216 22
2 237 256 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 74.98 44.56 105.41
5d_25C Five days - 25 degrees Celsius 76.63 46.01 107.26
7d_25C Seven days - 25 degrees Celsius 71.79 42.79 100.80
10d_25C Ten days - 25 degrees Celsius 95.51 58.19 132.83
7d_15C Seven days - 15 degrees Celsius 104.46 63.60 145.31
7d_30C Seven days - 30 degrees Celsius 60.25 35.13 85.36

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.952587 no
3d_25C 7d_25C 0.899168 no
3d_25C 7d_15C 0.150448 no
3d_25C 7d_30C 0.396456 no
3d_25C 10d_25C 0.322970 no
5d_25C 7d_25C 0.839974 no
5d_25C 7d_15C 0.176783 no
5d_25C 7d_30C 0.330769 no
5d_25C 10d_25C 0.368449 no
7d_25C 7d_15C 0.087906 no
7d_25C 7d_30C 0.513242 no
7d_25C 10d_25C 0.212309 no
7d_15C 7d_30C 0.006000 yes
7d_15C 10d_25C 0.761147 no
7d_30C 10d_25C 0.032406 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g351.t1
MADDDSHLSLSTPNSALGSSTSHFYPFATSPDIIRSHEKDSFLTGSLIQQSQGIVRALRGARYAHTHSDAIKHLT
ELLYFSLTTAIGNRTLGEEYCDLVQLEDDTLQLPSIGRRVGYFLSSILVPWTLQRLLPALRQRIRNKLERNIARQ
QSRAAQQAGLLNKPQFSTTPTKRPLFTKLRIQQYVLEHLDSITSLSPIYALSIATFYFTGSYYHISKRIWSLRYV
FTKKIDDNEQRIGYEVLGVLLVLQIAVQGFLHARKLAASMNEDESESTDAGQSPSQGGAVLASIQNPSSIPLLPA
SVPLYDLEEDPGAVSWIPEGQQRKCTLCLEMFKDPSVTTCGHVFCWICVRDWVREKPECPLCRQEVLLSKVLPLR
G*
Coding >Pro_DTO377G3_2|g351.t1
ATGGCCGACGACGACTCCCATCTCTCTCTATCAACCCCGAACTCAGCCCTCGGCTCCTCTACCTCTCACTTCTAC
CCTTTCGCAACCTCACCAGACATCATCCGCTCGCATGAGAAGGATTCATTCCTTACGGGCAGTCTAATTCAACAA
TCTCAAGGGATCGTTCGTGCTCTCCGCGGCGCCCGATACGCCCACACCCACTCCGACGCCATCAAACACCTCACA
GAACTCCTCTACTTCTCCCTAACAACCGCCATCGGCAACCGCACCCTAGGCGAAGAATACTGCGACCTCGTACAG
CTAGAAGATGACACACTTCAATTGCCGTCAATTGGCCGTCGCGTGGGGTACTTCTTAAGCAGCATTCTAGTACCG
TGGACACTGCAGCGGCTACTACCTGCATTGCGACAGAGGATCCGCAACAAGCTCGAGCGCAACATTGCACGCCAA
CAGTCACGAGCGGCGCAGCAGGCTGGCCTGCTCAACAAGCCCCAGTTCTCAACCACCCCGACTAAACGGCCGTTG
TTTACGAAACTGCGCATCCAGCAGTATGTCCTTGAACACCTGGACTCCATCACATCCTTGTCGCCCATTTATGCG
CTGAGTATTGCCACCTTCTATTTCACAGGCTCGTACTACCACATCTCCAAGCGGATTTGGAGCCTTCGTTACGTT
TTCACGAAAAAGATCGACGACAATGAGCAGCGCATCGGATATGAGGTTCTGGGTGTGTTGCTTGTTCTCCAAATC
GCCGTGCAGGGATTCCTGCACGCCCGCAAACTCGCCGCGAGCATGAATGAAGATGAGAGCGAGTCTACAGACGCT
GGTCAGTCTCCCTCGCAGGGTGGAGCTGTTCTCGCTTCGATTCAGAACCCGTCCTCTATTCCTCTCCTTCCTGCG
TCTGTGCCTCTGTATGATCTCGAGGAGGATCCTGGCGCTGTCTCATGGATTCCCGAGGGTCAGCAGCGGAAGTGC
ACCCTGTGTCTGGAAATGTTCAAGGACCCTAGTGTTACAACCTGTGGACATGTCTTTTGCTGGATTTGTGTTCGG
GACTGGGTTCGTGAAAAGCCCGAGTGCCCGCTCTGTCGGCAAGAGGTCTTGCTATCTAAGGTGCTTCCTCTAAGA
GGGTAG
Transcript >Pro_DTO377G3_2|g351.t1
ATGGCCGACGACGACTCCCATCTCTCTCTATCAACCCCGAACTCAGCCCTCGGCTCCTCTACCTCTCACTTCTAC
CCTTTCGCAACCTCACCAGACATCATCCGCTCGCATGAGAAGGATTCATTCCTTACGGGCAGTCTAATTCAACAA
TCTCAAGGGATCGTTCGTGCTCTCCGCGGCGCCCGATACGCCCACACCCACTCCGACGCCATCAAACACCTCACA
GAACTCCTCTACTTCTCCCTAACAACCGCCATCGGCAACCGCACCCTAGGCGAAGAATACTGCGACCTCGTACAG
CTAGAAGATGACACACTTCAATTGCCGTCAATTGGCCGTCGCGTGGGGTACTTCTTAAGCAGCATTCTAGTACCG
TGGACACTGCAGCGGCTACTACCTGCATTGCGACAGAGGATCCGCAACAAGCTCGAGCGCAACATTGCACGCCAA
CAGTCACGAGCGGCGCAGCAGGCTGGCCTGCTCAACAAGCCCCAGTTCTCAACCACCCCGACTAAACGGCCGTTG
TTTACGAAACTGCGCATCCAGCAGTATGTCCTTGAACACCTGGACTCCATCACATCCTTGTCGCCCATTTATGCG
CTGAGTATTGCCACCTTCTATTTCACAGGCTCGTACTACCACATCTCCAAGCGGATTTGGAGCCTTCGTTACGTT
TTCACGAAAAAGATCGACGACAATGAGCAGCGCATCGGATATGAGGTTCTGGGTGTGTTGCTTGTTCTCCAAATC
GCCGTGCAGGGATTCCTGCACGCCCGCAAACTCGCCGCGAGCATGAATGAAGATGAGAGCGAGTCTACAGACGCT
GGTCAGTCTCCCTCGCAGGGTGGAGCTGTTCTCGCTTCGATTCAGAACCCGTCCTCTATTCCTCTCCTTCCTGCG
TCTGTGCCTCTGTATGATCTCGAGGAGGATCCTGGCGCTGTCTCATGGATTCCCGAGGGTCAGCAGCGGAAGTGC
ACCCTGTGTCTGGAAATGTTCAAGGACCCTAGTGTTACAACCTGTGGACATGTCTTTTGCTGGATTTGTGTTCGG
GACTGGGTTCGTGAAAAGCCCGAGTGCCCGCTCTGTCGGCAAGAGGTCTTGCTATCTAAGGTGCTTCCTCTAAGA
GGGTAG
Gene >Pro_DTO377G3_2|g351.t1
ATGGCCGACGACGACTCCCATCTCTCTCTATCAACCCCGAACTCAGCCCTCGGCTCCTCTACCTCTCACTTCTAC
CCTTTCGCAACCTCACCAGACATCATCCGCTCGCATGAGAAGGATTCATTCCTTACGGGCAGTCTAATTCAACAA
TCTCAAGGGATCGTTCGTGCTCTCCGCGGCGCCCGATACGCCCACACCCACTCCGACGCCATCAAACACCTCACA
GAACTCCTCTACTTCTCCCTAACAACCGCCATCGGCAACCGCACCCTAGGCGAAGAATACTGCGACCTCGTACAG
CTAGAAGATGACACACTTCAATTGCCGTCAATTGGCCGTCGCGTGGGGTACTTCTTAAGCAGCATTCTAGTACCG
TGGACACTGCAGCGGCTACTACCTGCATTGCGACAGAGGATCCGCAACAAGCTCGAGCGCAACATTGCACGCCAA
CAGTCACGAGCGGCGCAGCAGGCTGGCCTGCTCAACAAGCCCCAGTTCTCAACCACCCCGACTAAACGGCCGTTG
TTTACGAAACTGCGCATCCAGCAGTATGTCCTTGAACACCTGGACTCCATCACATCCTTGTCGCCCATTTATGCG
CTGAGTATTGCCACCTTCTATTTCACAGGCTCGTACTACCACATCTCCAAGCGGATTTGGAGCCTTCGTTACGTT
TTCACGAAAAAGATCGACGACAATGAGCAGCGCATCGGATATGAGGTTCTGGGTGTGTTGCTTGTTCTCCAAATC
GCCGTGCAGGGATTCCTGCACGCCCGCAAACTCGCCGCGAGCATGAATGAAGATGAGAGCGAGTCTACAGACGCT
GGTCAGTCTCCCTCGCAGGGTGGAGCTGTTCTCGCTTCGATTCAGAACCCGTCCTCTATTCCTCTCCTTCCTGCG
TCTGTGCCTCTGTATGATCTCGAGGAGGATCCTGGCGCTGTCTCATGGATTCCCGAGGGTCAGCAGCGGAAGTGC
ACCCTGTGTCTGGAAATGTTCAAGGACCCTAGTGTTACAACCTGTGGACATGTCTTTTGCTGGATTTGTGTTCGG
GACTGGGTTCGTGAAAAGCCCGAGTGCCCGCTCTGTCGGCAAGAGGTCTTGCTATCTAAGGTGCTTCCTCTAAGA
GGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail