Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g351.t1
Gene name
Locationscaffold_01:886280..887411
Strand+
Gene length (bp)1131
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04757 Pex2_Pex12 Pex2 / Pex12 amino terminal region 2.9E-46 40 261
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 6.4E-12 324 362
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 6.9E-10 322 366
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 8.9E-10 325 362
PF13639 zf-RING_2 Ring finger domain 1.3E-09 324 363
PF13445 zf-RING_UBOX RING-type zinc-finger 8.3E-07 325 360
PF14447 Prok-RING_4 Prokaryotic RING finger family 4 9.6E-07 325 366

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 194 216 22
2 237 256 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g351.t1
MADDDSHLSLSTPNSALGSSTSHFYPFATSPDIIRSHEKDSFLTGSLIQQSQGIVRALRGARYAHTHSDAIKHLT
ELLYFSLTTAIGNRTLGEEYCDLVQLEDDTLQLPSIGRRVGYFLSSILVPWTLQRLLPALRQRIRNKLERNIARQ
QSRAAQQAGLLNKPQFSTTPTKRPLFTKLRIQQYVLEHLDSITSLSPIYALSIATFYFTGSYYHISKRIWSLRYV
FTKKIDDNEQRIGYEVLGVLLVLQIAVQGFLHARKLAASMNEDESESTDAGQSPSQGGAVLASIQNPSSIPLLPA
SVPLYDLEEDPGAVSWIPEGQQRKCTLCLEMFKDPSVTTCGHVFCWICVRDWVREKPECPLCRQEVLLSKVLPLR
G*
Coding >Pro_DTO377G3_2|g351.t1
ATGGCCGACGACGACTCCCATCTCTCTCTATCAACCCCGAACTCAGCCCTCGGCTCCTCTACCTCTCACTTCTAC
CCTTTCGCAACCTCACCAGACATCATCCGCTCGCATGAGAAGGATTCATTCCTTACGGGCAGTCTAATTCAACAA
TCTCAAGGGATCGTTCGTGCTCTCCGCGGCGCCCGATACGCCCACACCCACTCCGACGCCATCAAACACCTCACA
GAACTCCTCTACTTCTCCCTAACAACCGCCATCGGCAACCGCACCCTAGGCGAAGAATACTGCGACCTCGTACAG
CTAGAAGATGACACACTTCAATTGCCGTCAATTGGCCGTCGCGTGGGGTACTTCTTAAGCAGCATTCTAGTACCG
TGGACACTGCAGCGGCTACTACCTGCATTGCGACAGAGGATCCGCAACAAGCTCGAGCGCAACATTGCACGCCAA
CAGTCACGAGCGGCGCAGCAGGCTGGCCTGCTCAACAAGCCCCAGTTCTCAACCACCCCGACTAAACGGCCGTTG
TTTACGAAACTGCGCATCCAGCAGTATGTCCTTGAACACCTGGACTCCATCACATCCTTGTCGCCCATTTATGCG
CTGAGTATTGCCACCTTCTATTTCACAGGCTCGTACTACCACATCTCCAAGCGGATTTGGAGCCTTCGTTACGTT
TTCACGAAAAAGATCGACGACAATGAGCAGCGCATCGGATATGAGGTTCTGGGTGTGTTGCTTGTTCTCCAAATC
GCCGTGCAGGGATTCCTGCACGCCCGCAAACTCGCCGCGAGCATGAATGAAGATGAGAGCGAGTCTACAGACGCT
GGTCAGTCTCCCTCGCAGGGTGGAGCTGTTCTCGCTTCGATTCAGAACCCGTCCTCTATTCCTCTCCTTCCTGCG
TCTGTGCCTCTGTATGATCTCGAGGAGGATCCTGGCGCTGTCTCATGGATTCCCGAGGGTCAGCAGCGGAAGTGC
ACCCTGTGTCTGGAAATGTTCAAGGACCCTAGTGTTACAACCTGTGGACATGTCTTTTGCTGGATTTGTGTTCGG
GACTGGGTTCGTGAAAAGCCCGAGTGCCCGCTCTGTCGGCAAGAGGTCTTGCTATCTAAGGTGCTTCCTCTAAGA
GGGTAG
Transcript >Pro_DTO377G3_2|g351.t1
ATGGCCGACGACGACTCCCATCTCTCTCTATCAACCCCGAACTCAGCCCTCGGCTCCTCTACCTCTCACTTCTAC
CCTTTCGCAACCTCACCAGACATCATCCGCTCGCATGAGAAGGATTCATTCCTTACGGGCAGTCTAATTCAACAA
TCTCAAGGGATCGTTCGTGCTCTCCGCGGCGCCCGATACGCCCACACCCACTCCGACGCCATCAAACACCTCACA
GAACTCCTCTACTTCTCCCTAACAACCGCCATCGGCAACCGCACCCTAGGCGAAGAATACTGCGACCTCGTACAG
CTAGAAGATGACACACTTCAATTGCCGTCAATTGGCCGTCGCGTGGGGTACTTCTTAAGCAGCATTCTAGTACCG
TGGACACTGCAGCGGCTACTACCTGCATTGCGACAGAGGATCCGCAACAAGCTCGAGCGCAACATTGCACGCCAA
CAGTCACGAGCGGCGCAGCAGGCTGGCCTGCTCAACAAGCCCCAGTTCTCAACCACCCCGACTAAACGGCCGTTG
TTTACGAAACTGCGCATCCAGCAGTATGTCCTTGAACACCTGGACTCCATCACATCCTTGTCGCCCATTTATGCG
CTGAGTATTGCCACCTTCTATTTCACAGGCTCGTACTACCACATCTCCAAGCGGATTTGGAGCCTTCGTTACGTT
TTCACGAAAAAGATCGACGACAATGAGCAGCGCATCGGATATGAGGTTCTGGGTGTGTTGCTTGTTCTCCAAATC
GCCGTGCAGGGATTCCTGCACGCCCGCAAACTCGCCGCGAGCATGAATGAAGATGAGAGCGAGTCTACAGACGCT
GGTCAGTCTCCCTCGCAGGGTGGAGCTGTTCTCGCTTCGATTCAGAACCCGTCCTCTATTCCTCTCCTTCCTGCG
TCTGTGCCTCTGTATGATCTCGAGGAGGATCCTGGCGCTGTCTCATGGATTCCCGAGGGTCAGCAGCGGAAGTGC
ACCCTGTGTCTGGAAATGTTCAAGGACCCTAGTGTTACAACCTGTGGACATGTCTTTTGCTGGATTTGTGTTCGG
GACTGGGTTCGTGAAAAGCCCGAGTGCCCGCTCTGTCGGCAAGAGGTCTTGCTATCTAAGGTGCTTCCTCTAAGA
GGGTAG
Gene >Pro_DTO377G3_2|g351.t1
ATGGCCGACGACGACTCCCATCTCTCTCTATCAACCCCGAACTCAGCCCTCGGCTCCTCTACCTCTCACTTCTAC
CCTTTCGCAACCTCACCAGACATCATCCGCTCGCATGAGAAGGATTCATTCCTTACGGGCAGTCTAATTCAACAA
TCTCAAGGGATCGTTCGTGCTCTCCGCGGCGCCCGATACGCCCACACCCACTCCGACGCCATCAAACACCTCACA
GAACTCCTCTACTTCTCCCTAACAACCGCCATCGGCAACCGCACCCTAGGCGAAGAATACTGCGACCTCGTACAG
CTAGAAGATGACACACTTCAATTGCCGTCAATTGGCCGTCGCGTGGGGTACTTCTTAAGCAGCATTCTAGTACCG
TGGACACTGCAGCGGCTACTACCTGCATTGCGACAGAGGATCCGCAACAAGCTCGAGCGCAACATTGCACGCCAA
CAGTCACGAGCGGCGCAGCAGGCTGGCCTGCTCAACAAGCCCCAGTTCTCAACCACCCCGACTAAACGGCCGTTG
TTTACGAAACTGCGCATCCAGCAGTATGTCCTTGAACACCTGGACTCCATCACATCCTTGTCGCCCATTTATGCG
CTGAGTATTGCCACCTTCTATTTCACAGGCTCGTACTACCACATCTCCAAGCGGATTTGGAGCCTTCGTTACGTT
TTCACGAAAAAGATCGACGACAATGAGCAGCGCATCGGATATGAGGTTCTGGGTGTGTTGCTTGTTCTCCAAATC
GCCGTGCAGGGATTCCTGCACGCCCGCAAACTCGCCGCGAGCATGAATGAAGATGAGAGCGAGTCTACAGACGCT
GGTCAGTCTCCCTCGCAGGGTGGAGCTGTTCTCGCTTCGATTCAGAACCCGTCCTCTATTCCTCTCCTTCCTGCG
TCTGTGCCTCTGTATGATCTCGAGGAGGATCCTGGCGCTGTCTCATGGATTCCCGAGGGTCAGCAGCGGAAGTGC
ACCCTGTGTCTGGAAATGTTCAAGGACCCTAGTGTTACAACCTGTGGACATGTCTTTTGCTGGATTTGTGTTCGG
GACTGGGTTCGTGAAAAGCCCGAGTGCCCGCTCTGTCGGCAAGAGGTCTTGCTATCTAAGGTGCTTCCTCTAAGA
GGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail