Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3508.t1
Gene name
Locationscaffold_05:849993..854286
Strand-
Gene length (bp)4293
Transcript length (bp)4239
Coding sequence length (bp)4239
Protein length (aa) 1413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08605 Rad9_Rad53_bind Fungal Rad9-like Rad53-binding 1.4E-30 925 1071
PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain 8.9E-18 929 981
PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain 3.1E-07 1117 1242
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 1.0E-06 1118 1230

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3508.t1
METQDDSIDLAKLQRDALGLEHDPYLSRSTQKGNEPNHTLCYTSHKVNGASNGDGVCNGQQLPPKTPSNPASLVH
QYRPSLYRPRQHEPRTMMFNKSGNEPGIVPGSQFGNMSSAPGDTQVISQSVYDKIIRQNGESMQQDYTQTGADGA
TLRTLYEGDSGHIDLLSELDTVHHGTNLSQDDDDNDDGSNSDPNESSPMAYAPDLFPESQRFLAETPGTVVKKNE
AGGTAETPSISRNPLASGIESSGGLLGLSQVFGATQAPSSPIVHGLQTELVSDRPSPNIPIQSARVVNGISSPLM
GLPVQFTRDSSEPNMNYISMKESQKRRDKTLGERLTRSADNIQSDQSDKEFYKESSFIERARRQREIDEEAAAQF
AGLSAPARSTSNLSARLRTPSEQPGEQQDQEMIEAVASEEETEQEEDMQVPRSQEPPQSSAEEDKENYEGPPMDT
AAAAAAAASAHDRLSQVLGFEPILSPSRMRVDEQPDDGIAHGGSGSQPNGATSSSQAMVKDSQPSPQSSAKLIEP
EITRKITHRSPSRSHMNSPTRDLPSSPCSRPQSRHSNSHTQRNGSVSNEYAIQHVQTTALNENIPTYSSNPSEQQ
HLNSSHSRVEAGTSGNSSSMPSRVAETPMNQRLKHLGDMARLTSIPETSPSHSQCNSVAGSNGDGLNNEDDDLPP
MLFNEVPSIRNNHIRPAGARALSSPLKKLLSSPGGGQRRALTEIAGDLSPQVGAGGFDMGIGIFTAEDREFKALI
DGSPTRPKKKRRGNDGSSYIASDPIIPFTPRTQPPKSVAPIRATQERPAPIPEVPDSDDVPLVQLPEKAVRRQSK
PPRRAPENVWEIERSPEQPFRQRSRIGKTSTSMSTQGKYVSEKRSVPPPKVVVHSRPPPPSSELTEVSSTIASDD
IIESEAYSVDDSPTTPRPSHTLSENTVVAPSQVLSVWMGQKRAYYPATCFGTPLGVSQVKYSVRFEDSLPIEVPK
GAVKRFELRVGDAVKIEMDNIPKVTHVVRGFDDKLTKEELAKAADDGLYPITDIYGHTTIIVGPKQRKSLPNGGM
GNGENVIKVPISRVYLDTILWNQLKDRAFTYRPAPVQQESMVHTPSERSSAPASPSCRLSRSLHQGSGIFAGMVF
AVSYREDEASKNRVTRLIVDNGGTVLHDGFTELFEPSTIVSVDTPIKGGAKDAGINSKGLRLTALAEEVGFACLI
ADTYSRREKYMQALALNLPCLSGRWVEDCIAQGRVLDWDIYLLPAGDSMYLNGATKSRVMAPNPPSTARLTETIS
ARKKLLAGQSVLVVMGRGKVEEKRKAYIFLTYALGASRVERVPDLGTASALIDSQSDAGLSTDWDWIYVDDADQA
AAKSMLTPKPQTPRIHLFHGKKRKRSIASSTPTPPNEPKCTARVVGNEFVCQSLILGRLFEE*
Coding >Pro_DTO377G3_2|g3508.t1
ATGGAAACCCAGGACGATAGCATCGACCTTGCAAAGTTGCAACGCGACGCGTTGGGGCTAGAGCACGATCCGTAC
CTTTCCAGATCTACACAAAAAGGTAACGAGCCGAATCACACTCTTTGTTACACATCCCACAAAGTCAACGGTGCT
TCCAATGGTGACGGAGTGTGCAACGGCCAACAGTTACCTCCGAAAACACCATCAAACCCAGCGAGCCTTGTGCAC
CAATACCGACCCTCTTTGTATCGACCTCGTCAGCATGAACCACGCACAATGATGTTCAATAAAAGTGGCAATGAA
CCGGGCATCGTACCAGGATCGCAATTCGGCAACATGAGCTCCGCTCCTGGGGATACCCAGGTCATCTCTCAGTCA
GTGTACGACAAGATTATCAGACAAAATGGGGAGTCCATGCAACAAGATTATACACAAACGGGAGCCGATGGAGCG
ACATTGAGAACACTGTATGAGGGGGACAGTGGCCATATCGACCTGCTTTCCGAACTGGACACCGTGCACCACGGA
ACGAACCTCTCCCAAGATGACGATGACAACGACGACGGGAGCAATTCCGATCCGAACGAGTCTTCTCCAATGGCT
TATGCACCCGATTTATTCCCCGAATCGCAACGATTCCTAGCAGAAACACCCGGAACAGTGGTGAAAAAAAATGAG
GCGGGTGGGACAGCAGAGACCCCGAGCATCTCGCGGAATCCCCTGGCTAGTGGCATCGAGTCAAGTGGTGGGCTT
CTTGGGCTGAGCCAGGTTTTCGGAGCTACCCAGGCCCCGTCGTCTCCCATTGTCCACGGCCTGCAGACGGAGCTT
GTATCGGATCGCCCGTCGCCCAATATCCCAATTCAATCCGCTCGTGTTGTCAATGGTATCTCGTCGCCTTTGATG
GGCTTGCCGGTTCAGTTCACGAGAGACTCATCCGAACCGAATATGAACTATATATCGATGAAGGAATCGCAGAAA
AGGCGCGATAAGACTTTGGGGGAGAGGTTGACTCGGTCGGCCGACAATATCCAGTCGGACCAGAGTGACAAGGAA
TTCTATAAAGAGTCGAGCTTTATAGAACGTGCACGACGACAGCGAGAGATTGACGAGGAAGCTGCGGCTCAATTC
GCCGGGTTGAGTGCTCCTGCCAGATCTACATCCAATCTCTCCGCCAGACTACGGACTCCCTCCGAGCAGCCCGGT
GAACAACAAGACCAGGAAATGATAGAAGCTGTTGCCAGCGAGGAAGAAACCGAACAAGAGGAAGATATGCAAGTG
CCCAGGTCACAAGAGCCTCCTCAATCTTCAGCCGAAGAAGATAAAGAGAACTACGAGGGGCCTCCAATGGATACT
GCTGCTGCCGCCGCCGCCGCTGCCAGTGCCCACGATCGACTATCTCAGGTACTTGGGTTTGAGCCGATTCTCTCC
CCATCTCGCATGCGAGTAGACGAGCAACCGGATGATGGCATAGCTCATGGAGGCTCTGGTAGTCAGCCGAACGGT
GCTACAAGTTCTTCCCAGGCCATGGTGAAAGACTCTCAACCATCACCTCAGTCATCGGCAAAGCTCATAGAACCC
GAAATTACTAGGAAAATTACTCATCGGTCGCCTTCGCGTTCGCATATGAATTCTCCTACTCGAGACCTTCCCTCC
TCTCCCTGCTCGCGACCACAATCAAGACATTCGAACAGCCATACTCAGAGAAATGGCTCCGTATCAAATGAATAT
GCCATCCAACATGTTCAGACTACTGCTCTTAACGAGAATATACCAACATACTCTAGCAACCCCTCGGAGCAGCAA
CATCTAAACTCATCGCATTCCAGGGTGGAAGCGGGAACTTCGGGCAACTCATCATCGATGCCATCCCGTGTGGCT
GAGACACCTATGAATCAACGTCTTAAGCATCTCGGTGACATGGCTCGATTGACGAGTATCCCAGAAACAAGTCCC
AGTCACTCCCAGTGCAATTCCGTGGCTGGGTCCAATGGTGATGGACTCAATAATGAAGACGACGATCTTCCACCT
ATGTTGTTCAATGAAGTCCCCAGTATTCGAAATAATCATATCCGCCCAGCCGGGGCAAGGGCACTCTCTTCGCCT
CTCAAAAAGCTGTTGTCCAGTCCGGGCGGAGGCCAACGCAGGGCTTTGACAGAAATTGCGGGAGATCTTTCCCCG
CAGGTCGGGGCTGGAGGATTTGATATGGGTATTGGAATTTTCACTGCTGAGGATCGAGAATTCAAAGCCCTGATC
GATGGATCGCCGACTCGACCGAAGAAAAAACGGCGTGGCAACGATGGCTCGAGTTACATTGCCTCCGACCCTATC
ATACCTTTCACCCCTCGCACACAGCCCCCAAAATCCGTTGCACCTATTCGAGCAACACAAGAACGACCGGCTCCC
ATTCCTGAAGTTCCAGATTCGGATGATGTGCCTTTAGTGCAACTCCCCGAAAAAGCCGTACGAAGGCAATCAAAG
CCCCCGCGACGAGCCCCTGAGAATGTTTGGGAAATCGAGAGATCGCCTGAGCAGCCCTTCCGCCAGAGATCAAGA
ATTGGCAAGACTTCTACCTCGATGTCTACGCAAGGGAAGTATGTCTCAGAAAAGAGATCAGTACCCCCACCAAAG
GTTGTCGTTCATAGTCGACCACCACCTCCATCGTCAGAGCTCACTGAGGTTTCATCAACAATTGCCTCGGATGAT
ATAATTGAGTCAGAGGCGTACAGTGTCGATGACTCGCCGACTACGCCTCGACCATCTCACACCTTATCGGAAAAC
ACCGTGGTCGCTCCAAGTCAGGTTCTTTCTGTCTGGATGGGTCAGAAACGCGCATACTATCCAGCGACATGCTTT
GGGACACCGCTAGGTGTATCACAGGTTAAATACTCTGTGAGGTTTGAGGACAGTCTTCCTATTGAGGTACCGAAG
GGTGCCGTTAAGAGATTTGAGCTTCGCGTCGGAGACGCTGTCAAGATCGAGATGGATAATATTCCAAAGGTCACT
CATGTCGTTCGGGGATTCGACGACAAGCTTACTAAAGAAGAGTTGGCTAAAGCCGCTGACGATGGCCTCTATCCT
ATAACCGACATTTACGGTCATACCACTATCATAGTCGGTCCCAAGCAACGCAAAAGTCTGCCAAATGGAGGGATG
GGCAACGGCGAGAATGTGATTAAAGTACCTATATCTCGTGTCTATCTTGATACTATCCTGTGGAATCAACTGAAA
GATCGCGCGTTCACATATCGCCCGGCGCCTGTTCAACAAGAGAGCATGGTCCATACCCCATCCGAAAGGTCATCC
GCGCCTGCTTCACCCAGTTGTCGCTTGTCCCGCAGCCTTCACCAAGGTAGCGGAATCTTTGCTGGTATGGTGTTT
GCCGTATCTTACAGGGAGGATGAAGCATCCAAAAATCGTGTGACCAGGTTAATCGTCGACAATGGCGGCACTGTA
TTACATGATGGATTTACTGAGTTATTCGAGCCTTCAACAATTGTTTCTGTTGATACTCCCATCAAAGGTGGAGCC
AAGGATGCAGGTATCAATAGCAAGGGTCTCCGACTTACAGCTCTTGCTGAGGAAGTCGGCTTTGCTTGTTTAATT
GCCGATACCTATTCTCGGCGAGAAAAATACATGCAAGCACTGGCATTGAACCTCCCATGCCTGTCCGGGCGGTGG
GTAGAGGACTGCATCGCCCAAGGTCGCGTCCTTGACTGGGATATCTACCTCCTCCCAGCCGGCGACTCAATGTAC
CTCAATGGAGCGACAAAATCTAGAGTCATGGCTCCCAACCCTCCATCCACAGCCCGCCTCACCGAAACCATCTCC
GCACGAAAAAAGTTGCTCGCAGGGCAATCGGTGCTCGTTGTCATGGGCCGTGGGAAGGTCGAGGAAAAGAGGAAA
GCCTACATCTTCCTGACTTACGCCCTAGGGGCTTCCCGGGTTGAGCGTGTTCCTGATCTCGGCACGGCCAGCGCA
TTAATAGACTCGCAGTCTGATGCCGGTCTGTCGACGGACTGGGACTGGATCTATGTTGACGATGCAGATCAAGCT
GCTGCAAAGTCGATGTTGACACCCAAACCGCAGACGCCGAGAATTCACTTGTTCCATGGGAAGAAGCGTAAGAGG
TCGATTGCATCGTCCACTCCTACACCCCCTAATGAGCCAAAATGTACCGCGAGGGTTGTCGGTAATGAGTTTGTT
TGCCAAAGTTTGATTTTAGGTCGCTTGTTTGAGGAGTGA
Transcript >Pro_DTO377G3_2|g3508.t1
ATGGAAACCCAGGACGATAGCATCGACCTTGCAAAGTTGCAACGCGACGCGTTGGGGCTAGAGCACGATCCGTAC
CTTTCCAGATCTACACAAAAAGGTAACGAGCCGAATCACACTCTTTGTTACACATCCCACAAAGTCAACGGTGCT
TCCAATGGTGACGGAGTGTGCAACGGCCAACAGTTACCTCCGAAAACACCATCAAACCCAGCGAGCCTTGTGCAC
CAATACCGACCCTCTTTGTATCGACCTCGTCAGCATGAACCACGCACAATGATGTTCAATAAAAGTGGCAATGAA
CCGGGCATCGTACCAGGATCGCAATTCGGCAACATGAGCTCCGCTCCTGGGGATACCCAGGTCATCTCTCAGTCA
GTGTACGACAAGATTATCAGACAAAATGGGGAGTCCATGCAACAAGATTATACACAAACGGGAGCCGATGGAGCG
ACATTGAGAACACTGTATGAGGGGGACAGTGGCCATATCGACCTGCTTTCCGAACTGGACACCGTGCACCACGGA
ACGAACCTCTCCCAAGATGACGATGACAACGACGACGGGAGCAATTCCGATCCGAACGAGTCTTCTCCAATGGCT
TATGCACCCGATTTATTCCCCGAATCGCAACGATTCCTAGCAGAAACACCCGGAACAGTGGTGAAAAAAAATGAG
GCGGGTGGGACAGCAGAGACCCCGAGCATCTCGCGGAATCCCCTGGCTAGTGGCATCGAGTCAAGTGGTGGGCTT
CTTGGGCTGAGCCAGGTTTTCGGAGCTACCCAGGCCCCGTCGTCTCCCATTGTCCACGGCCTGCAGACGGAGCTT
GTATCGGATCGCCCGTCGCCCAATATCCCAATTCAATCCGCTCGTGTTGTCAATGGTATCTCGTCGCCTTTGATG
GGCTTGCCGGTTCAGTTCACGAGAGACTCATCCGAACCGAATATGAACTATATATCGATGAAGGAATCGCAGAAA
AGGCGCGATAAGACTTTGGGGGAGAGGTTGACTCGGTCGGCCGACAATATCCAGTCGGACCAGAGTGACAAGGAA
TTCTATAAAGAGTCGAGCTTTATAGAACGTGCACGACGACAGCGAGAGATTGACGAGGAAGCTGCGGCTCAATTC
GCCGGGTTGAGTGCTCCTGCCAGATCTACATCCAATCTCTCCGCCAGACTACGGACTCCCTCCGAGCAGCCCGGT
GAACAACAAGACCAGGAAATGATAGAAGCTGTTGCCAGCGAGGAAGAAACCGAACAAGAGGAAGATATGCAAGTG
CCCAGGTCACAAGAGCCTCCTCAATCTTCAGCCGAAGAAGATAAAGAGAACTACGAGGGGCCTCCAATGGATACT
GCTGCTGCCGCCGCCGCCGCTGCCAGTGCCCACGATCGACTATCTCAGGTACTTGGGTTTGAGCCGATTCTCTCC
CCATCTCGCATGCGAGTAGACGAGCAACCGGATGATGGCATAGCTCATGGAGGCTCTGGTAGTCAGCCGAACGGT
GCTACAAGTTCTTCCCAGGCCATGGTGAAAGACTCTCAACCATCACCTCAGTCATCGGCAAAGCTCATAGAACCC
GAAATTACTAGGAAAATTACTCATCGGTCGCCTTCGCGTTCGCATATGAATTCTCCTACTCGAGACCTTCCCTCC
TCTCCCTGCTCGCGACCACAATCAAGACATTCGAACAGCCATACTCAGAGAAATGGCTCCGTATCAAATGAATAT
GCCATCCAACATGTTCAGACTACTGCTCTTAACGAGAATATACCAACATACTCTAGCAACCCCTCGGAGCAGCAA
CATCTAAACTCATCGCATTCCAGGGTGGAAGCGGGAACTTCGGGCAACTCATCATCGATGCCATCCCGTGTGGCT
GAGACACCTATGAATCAACGTCTTAAGCATCTCGGTGACATGGCTCGATTGACGAGTATCCCAGAAACAAGTCCC
AGTCACTCCCAGTGCAATTCCGTGGCTGGGTCCAATGGTGATGGACTCAATAATGAAGACGACGATCTTCCACCT
ATGTTGTTCAATGAAGTCCCCAGTATTCGAAATAATCATATCCGCCCAGCCGGGGCAAGGGCACTCTCTTCGCCT
CTCAAAAAGCTGTTGTCCAGTCCGGGCGGAGGCCAACGCAGGGCTTTGACAGAAATTGCGGGAGATCTTTCCCCG
CAGGTCGGGGCTGGAGGATTTGATATGGGTATTGGAATTTTCACTGCTGAGGATCGAGAATTCAAAGCCCTGATC
GATGGATCGCCGACTCGACCGAAGAAAAAACGGCGTGGCAACGATGGCTCGAGTTACATTGCCTCCGACCCTATC
ATACCTTTCACCCCTCGCACACAGCCCCCAAAATCCGTTGCACCTATTCGAGCAACACAAGAACGACCGGCTCCC
ATTCCTGAAGTTCCAGATTCGGATGATGTGCCTTTAGTGCAACTCCCCGAAAAAGCCGTACGAAGGCAATCAAAG
CCCCCGCGACGAGCCCCTGAGAATGTTTGGGAAATCGAGAGATCGCCTGAGCAGCCCTTCCGCCAGAGATCAAGA
ATTGGCAAGACTTCTACCTCGATGTCTACGCAAGGGAAGTATGTCTCAGAAAAGAGATCAGTACCCCCACCAAAG
GTTGTCGTTCATAGTCGACCACCACCTCCATCGTCAGAGCTCACTGAGGTTTCATCAACAATTGCCTCGGATGAT
ATAATTGAGTCAGAGGCGTACAGTGTCGATGACTCGCCGACTACGCCTCGACCATCTCACACCTTATCGGAAAAC
ACCGTGGTCGCTCCAAGTCAGGTTCTTTCTGTCTGGATGGGTCAGAAACGCGCATACTATCCAGCGACATGCTTT
GGGACACCGCTAGGTGTATCACAGGTTAAATACTCTGTGAGGTTTGAGGACAGTCTTCCTATTGAGGTACCGAAG
GGTGCCGTTAAGAGATTTGAGCTTCGCGTCGGAGACGCTGTCAAGATCGAGATGGATAATATTCCAAAGGTCACT
CATGTCGTTCGGGGATTCGACGACAAGCTTACTAAAGAAGAGTTGGCTAAAGCCGCTGACGATGGCCTCTATCCT
ATAACCGACATTTACGGTCATACCACTATCATAGTCGGTCCCAAGCAACGCAAAAGTCTGCCAAATGGAGGGATG
GGCAACGGCGAGAATGTGATTAAAGTACCTATATCTCGTGTCTATCTTGATACTATCCTGTGGAATCAACTGAAA
GATCGCGCGTTCACATATCGCCCGGCGCCTGTTCAACAAGAGAGCATGGTCCATACCCCATCCGAAAGGTCATCC
GCGCCTGCTTCACCCAGTTGTCGCTTGTCCCGCAGCCTTCACCAAGGTAGCGGAATCTTTGCTGGTATGGTGTTT
GCCGTATCTTACAGGGAGGATGAAGCATCCAAAAATCGTGTGACCAGGTTAATCGTCGACAATGGCGGCACTGTA
TTACATGATGGATTTACTGAGTTATTCGAGCCTTCAACAATTGTTTCTGTTGATACTCCCATCAAAGGTGGAGCC
AAGGATGCAGGTATCAATAGCAAGGGTCTCCGACTTACAGCTCTTGCTGAGGAAGTCGGCTTTGCTTGTTTAATT
GCCGATACCTATTCTCGGCGAGAAAAATACATGCAAGCACTGGCATTGAACCTCCCATGCCTGTCCGGGCGGTGG
GTAGAGGACTGCATCGCCCAAGGTCGCGTCCTTGACTGGGATATCTACCTCCTCCCAGCCGGCGACTCAATGTAC
CTCAATGGAGCGACAAAATCTAGAGTCATGGCTCCCAACCCTCCATCCACAGCCCGCCTCACCGAAACCATCTCC
GCACGAAAAAAGTTGCTCGCAGGGCAATCGGTGCTCGTTGTCATGGGCCGTGGGAAGGTCGAGGAAAAGAGGAAA
GCCTACATCTTCCTGACTTACGCCCTAGGGGCTTCCCGGGTTGAGCGTGTTCCTGATCTCGGCACGGCCAGCGCA
TTAATAGACTCGCAGTCTGATGCCGGTCTGTCGACGGACTGGGACTGGATCTATGTTGACGATGCAGATCAAGCT
GCTGCAAAGTCGATGTTGACACCCAAACCGCAGACGCCGAGAATTCACTTGTTCCATGGGAAGAAGCGTAAGAGG
TCGATTGCATCGTCCACTCCTACACCCCCTAATGAGCCAAAATGTACCGCGAGGGTTGTCGGTAATGAGTTTGTT
TGCCAAAGTTTGATTTTAGGTCGCTTGTTTGAGGAGTGA
Gene >Pro_DTO377G3_2|g3508.t1
ATGGAAACCCAGGACGATAGCATCGACCTTGCAAAGTTGCAACGCGACGCGTTGGGGCTAGTATGTAACGACCCT
GCAGCGTCCCTCTCATTGGACTAACTCCGACATCCCCAGGAGCACGATCCGTACCTTTCCAGATCTACACAAAAA
GGTAACGAGCCGAATCACACTCTTTGTTACACATCCCACAAAGTCAACGGTGCTTCCAATGGTGACGGAGTGTGC
AACGGCCAACAGTTACCTCCGAAAACACCATCAAACCCAGCGAGCCTTGTGCACCAATACCGACCCTCTTTGTAT
CGACCTCGTCAGCATGAACCACGCACAATGATGTTCAATAAAAGTGGCAATGAACCGGGCATCGTACCAGGATCG
CAATTCGGCAACATGAGCTCCGCTCCTGGGGATACCCAGGTCATCTCTCAGTCAGTGTACGACAAGATTATCAGA
CAAAATGGGGAGTCCATGCAACAAGATTATACACAAACGGGAGCCGATGGAGCGACATTGAGAACACTGTATGAG
GGGGACAGTGGCCATATCGACCTGCTTTCCGAACTGGACACCGTGCACCACGGAACGAACCTCTCCCAAGATGAC
GATGACAACGACGACGGGAGCAATTCCGATCCGAACGAGTCTTCTCCAATGGCTTATGCACCCGATTTATTCCCC
GAATCGCAACGATTCCTAGCAGAAACACCCGGAACAGTGGTGAAAAAAAATGAGGCGGGTGGGACAGCAGAGACC
CCGAGCATCTCGCGGAATCCCCTGGCTAGTGGCATCGAGTCAAGTGGTGGGCTTCTTGGGCTGAGCCAGGTTTTC
GGAGCTACCCAGGCCCCGTCGTCTCCCATTGTCCACGGCCTGCAGACGGAGCTTGTATCGGATCGCCCGTCGCCC
AATATCCCAATTCAATCCGCTCGTGTTGTCAATGGTATCTCGTCGCCTTTGATGGGCTTGCCGGTTCAGTTCACG
AGAGACTCATCCGAACCGAATATGAACTATATATCGATGAAGGAATCGCAGAAAAGGCGCGATAAGACTTTGGGG
GAGAGGTTGACTCGGTCGGCCGACAATATCCAGTCGGACCAGAGTGACAAGGAATTCTATAAAGAGTCGAGCTTT
ATAGAACGTGCACGACGACAGCGAGAGATTGACGAGGAAGCTGCGGCTCAATTCGCCGGGTTGAGTGCTCCTGCC
AGATCTACATCCAATCTCTCCGCCAGACTACGGACTCCCTCCGAGCAGCCCGGTGAACAACAAGACCAGGAAATG
ATAGAAGCTGTTGCCAGCGAGGAAGAAACCGAACAAGAGGAAGATATGCAAGTGCCCAGGTCACAAGAGCCTCCT
CAATCTTCAGCCGAAGAAGATAAAGAGAACTACGAGGGGCCTCCAATGGATACTGCTGCTGCCGCCGCCGCCGCT
GCCAGTGCCCACGATCGACTATCTCAGGTACTTGGGTTTGAGCCGATTCTCTCCCCATCTCGCATGCGAGTAGAC
GAGCAACCGGATGATGGCATAGCTCATGGAGGCTCTGGTAGTCAGCCGAACGGTGCTACAAGTTCTTCCCAGGCC
ATGGTGAAAGACTCTCAACCATCACCTCAGTCATCGGCAAAGCTCATAGAACCCGAAATTACTAGGAAAATTACT
CATCGGTCGCCTTCGCGTTCGCATATGAATTCTCCTACTCGAGACCTTCCCTCCTCTCCCTGCTCGCGACCACAA
TCAAGACATTCGAACAGCCATACTCAGAGAAATGGCTCCGTATCAAATGAATATGCCATCCAACATGTTCAGACT
ACTGCTCTTAACGAGAATATACCAACATACTCTAGCAACCCCTCGGAGCAGCAACATCTAAACTCATCGCATTCC
AGGGTGGAAGCGGGAACTTCGGGCAACTCATCATCGATGCCATCCCGTGTGGCTGAGACACCTATGAATCAACGT
CTTAAGCATCTCGGTGACATGGCTCGATTGACGAGTATCCCAGAAACAAGTCCCAGTCACTCCCAGTGCAATTCC
GTGGCTGGGTCCAATGGTGATGGACTCAATAATGAAGACGACGATCTTCCACCTATGTTGTTCAATGAAGTCCCC
AGTATTCGAAATAATCATATCCGCCCAGCCGGGGCAAGGGCACTCTCTTCGCCTCTCAAAAAGCTGTTGTCCAGT
CCGGGCGGAGGCCAACGCAGGGCTTTGACAGAAATTGCGGGAGATCTTTCCCCGCAGGTCGGGGCTGGAGGATTT
GATATGGGTATTGGAATTTTCACTGCTGAGGATCGAGAATTCAAAGCCCTGATCGATGGATCGCCGACTCGACCG
AAGAAAAAACGGCGTGGCAACGATGGCTCGAGTTACATTGCCTCCGACCCTATCATACCTTTCACCCCTCGCACA
CAGCCCCCAAAATCCGTTGCACCTATTCGAGCAACACAAGAACGACCGGCTCCCATTCCTGAAGTTCCAGATTCG
GATGATGTGCCTTTAGTGCAACTCCCCGAAAAAGCCGTACGAAGGCAATCAAAGCCCCCGCGACGAGCCCCTGAG
AATGTTTGGGAAATCGAGAGATCGCCTGAGCAGCCCTTCCGCCAGAGATCAAGAATTGGCAAGACTTCTACCTCG
ATGTCTACGCAAGGGAAGTATGTCTCAGAAAAGAGATCAGTACCCCCACCAAAGGTTGTCGTTCATAGTCGACCA
CCACCTCCATCGTCAGAGCTCACTGAGGTTTCATCAACAATTGCCTCGGATGATATAATTGAGTCAGAGGCGTAC
AGTGTCGATGACTCGCCGACTACGCCTCGACCATCTCACACCTTATCGGAAAACACCGTGGTCGCTCCAAGTCAG
GTTCTTTCTGTCTGGATGGGTCAGAAACGCGCATACTATCCAGCGACATGCTTTGGGACACCGCTAGGTGTATCA
CAGGTTAAATACTCTGTGAGGTTTGAGGACAGTCTTCCTATTGAGGTACCGAAGGGTGCCGTTAAGAGATTTGAG
CTTCGCGTCGGAGACGCTGTCAAGATCGAGATGGATAATATTCCAAAGGTCACTCATGTCGTTCGGGGATTCGAC
GACAAGCTTACTAAAGAAGAGTTGGCTAAAGCCGCTGACGATGGCCTCTATCCTATAACCGACATTTACGGTCAT
ACCACTATCATAGTCGGTCCCAAGCAACGCAAAAGTCTGCCAAATGGAGGGATGGGCAACGGCGAGAATGTGATT
AAAGTACCTATATCTCGTGTCTATCTTGATACTATCCTGTGGAATCAACTGAAAGATCGCGCGTTCACATATCGC
CCGGCGCCTGTTCAACAAGAGAGCATGGTCCATACCCCATCCGAAAGGTCATCCGCGCCTGCTTCACCCAGTTGT
CGCTTGTCCCGCAGCCTTCACCAAGGTAGCGGAATCTTTGCTGGTATGGTGTTTGCCGTATCTTACAGGGAGGAT
GAAGCATCCAAAAATCGTGTGACCAGGTTAATCGTCGACAATGGCGGCACTGTATTACATGATGGATTTACTGAG
TTATTCGAGCCTTCAACAATTGTTTCTGTTGATACTCCCATCAAAGGTGGAGCCAAGGATGCAGGTATCAATAGC
AAGGGTCTCCGACTTACAGCTCTTGCTGAGGAAGTCGGCTTTGCTTGTTTAATTGCCGATACCTATTCTCGGCGA
GAAAAATACATGCAAGCACTGGCATTGAACCTCCCATGCCTGTCCGGGCGGTGGGTAGAGGACTGCATCGCCCAA
GGTCGCGTCCTTGACTGGGATATCTACCTCCTCCCAGCCGGCGACTCAATGTACCTCAATGGAGCGACAAAATCT
AGAGTCATGGCTCCCAACCCTCCATCCACAGCCCGCCTCACCGAAACCATCTCCGCACGAAAAAAGTTGCTCGCA
GGGCAATCGGTGCTCGTTGTCATGGGCCGTGGGAAGGTCGAGGAAAAGAGGAAAGCCTACATCTTCCTGACTTAC
GCCCTAGGGGCTTCCCGGGTTGAGCGTGTTCCTGATCTCGGCACGGCCAGCGCATTAATAGACTCGCAGTCTGAT
GCCGGTCTGTCGACGGACTGGGACTGGATCTATGTTGACGATGCAGATCAAGCTGCTGCAAAGTCGATGTTGACA
CCCAAACCGCAGACGCCGAGAATTCACTTGTTCCATGGGAAGAAGCGTAAGAGGTCGATTGCATCGTCCACTCCT
ACACCCCCTAATGAGCCAAAATGTACCGCGAGGGTTGTCGGTAATGAGTTTGTTTGCCAAAGTTTGATTTTAGGT
CGCTTGTTTGAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail