Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3485.t1
Gene name
Locationscaffold_05:797455..798002
Strand+
Gene length (bp)547
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01185 Hydrophobin Fungal hydrophobin 1.2E-08 60 159

GO

GO Term Description Terminal node
GO:0009277 fungal-type cell wall Yes
GO:0005199 structural constituent of cell wall Yes
GO:0005198 structural molecule activity No
GO:0030312 external encapsulating structure No
GO:0005618 cell wall No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 34078.70 10611.60 57545.8
5d_25C Five days - 25 degrees Celsius 21215.70 6437.37 35994.0
7d_25C Seven days - 25 degrees Celsius 19987.70 5208.66 34766.7
10d_25C Ten days - 25 degrees Celsius 9936.22 2660.05 17212.4
7d_15C Seven days - 15 degrees Celsius 20780.80 7.20 41554.4
7d_30C Seven days - 30 degrees Celsius 14470.60 4315.62 24625.7

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.240174 no
3d_25C 7d_25C 0.182220 no
3d_25C 7d_15C 0.307944 no
3d_25C 7d_30C 0.015833 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.920621 no
5d_25C 7d_15C 0.976838 no
5d_25C 7d_30C 0.360121 no
5d_25C 10d_25C 0.049197 yes
7d_25C 7d_15C 0.958413 no
7d_25C 7d_30C 0.472678 no
7d_25C 10d_25C 0.077682 no
7d_15C 7d_30C 0.477127 no
7d_15C 10d_25C 0.115258 no
7d_30C 10d_25C 0.392296 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3485.t1
MQFSLSAIVLGLAATVYALPPGGASAGGAGSGNGVGNKGNTDVRFAVPDNMTVKQAQAKCGDQAQLSCCNKAVYA
GDTTDINSGILGGTLSNLIGSGSGASGLGLFDQCSKLDLQIPVLIGVPIQDLINQKCKQNIACCQNSPSSANSDL
IGLGLPCVALGSIL*
Coding >Pro_DTO377G3_2|g3485.t1
ATGCAGTTCTCTCTCTCCGCCATTGTCCTCGGCCTCGCTGCCACTGTCTACGCTCTTCCCCCTGGAGGCGCCTCC
GCTGGTGGTGCTGGCTCCGGCAACGGTGTCGGCAACAAGGGCAACACCGACGTTCGCTTCGCTGTCCCCGACAAC
ATGACTGTCAAGCAGGCTCAGGCCAAGTGTGGTGACCAGGCCCAGCTCTCTTGCTGCAACAAGGCTGTCTACGCC
GGTGACACCACCGACATCAACTCCGGAATCCTCGGTGGTACCCTCAGCAACCTGATCGGCTCCGGATCCGGTGCT
TCTGGCCTCGGTCTCTTCGACCAGTGCTCCAAGCTGGATCTCCAGATCCCCGTCCTCATTGGTGTCCCCATCCAG
GATCTCATCAACCAGAAGTGCAAGCAGAACATTGCCTGCTGCCAGAACTCTCCTTCCAGCGCCAACTCCGACCTC
ATCGGTCTCGGCCTCCCCTGTGTTGCCCTTGGCTCCATCCTCTAA
Transcript >Pro_DTO377G3_2|g3485.t1
ATGCAGTTCTCTCTCTCCGCCATTGTCCTCGGCCTCGCTGCCACTGTCTACGCTCTTCCCCCTGGAGGCGCCTCC
GCTGGTGGTGCTGGCTCCGGCAACGGTGTCGGCAACAAGGGCAACACCGACGTTCGCTTCGCTGTCCCCGACAAC
ATGACTGTCAAGCAGGCTCAGGCCAAGTGTGGTGACCAGGCCCAGCTCTCTTGCTGCAACAAGGCTGTCTACGCC
GGTGACACCACCGACATCAACTCCGGAATCCTCGGTGGTACCCTCAGCAACCTGATCGGCTCCGGATCCGGTGCT
TCTGGCCTCGGTCTCTTCGACCAGTGCTCCAAGCTGGATCTCCAGATCCCCGTCCTCATTGGTGTCCCCATCCAG
GATCTCATCAACCAGAAGTGCAAGCAGAACATTGCCTGCTGCCAGAACTCTCCTTCCAGCGCCAACTCCGACCTC
ATCGGTCTCGGCCTCCCCTGTGTTGCCCTTGGCTCCATCCTCTAA
Gene >Pro_DTO377G3_2|g3485.t1
ATGCAGTTCTCTCTCTCCGCCATTGTCCTCGGCCTCGCTGCCACTGTCTACGCTCTTCCCCCTGGAGGCGCCTCC
GCTGGTGGTGCTGGCTCCGGCAACGGTGTCGGCAACAAGGGCAACACCGACGTTCGCTTCGCTGTCCCCGACAAC
ATGACTGTCAAGCAGGCTCAGGCCAAGTGTGGTGACCAGGCCCAGCTCTCTTGCTGCAACAAGGCTGTCTACGCC
GGTGACACCACCGACATCAACTCCGGAATCCTCGGTGGTACCCTCAGCAACCTGATCGGCTCCGGATCCGGTGCT
TCTGGCCTCGGTCTCTTCGACCAGTGCTCCAAGCTGGATCTCCAGATCCCCGTCCTCATTGGTGTCCCCATCCAG
GATCTCATCAACCAGAAGTGCAAGCAGAACATTGCCTGCTGCCAGAACTCTCCTTCCAGCGCCGTTAGTGCTCCA
ACATCCACGCTATTTCGACTACAACTGACATATCTTACAGAACTCCGACCTCATCGGTCTCGGCCTCCCCTGTGT
TGCCCTTGGCTCCATCCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail