Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3485.t1
Gene name
Locationscaffold_05:797455..798002
Strand+
Gene length (bp)547
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01185 Hydrophobin Fungal hydrophobin 1.2E-08 60 159

GO

GO Term Description Terminal node
GO:0009277 fungal-type cell wall Yes
GO:0005199 structural constituent of cell wall Yes
GO:0005198 structural molecule activity No
GO:0030312 external encapsulating structure No
GO:0005618 cell wall No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3485.t1
MQFSLSAIVLGLAATVYALPPGGASAGGAGSGNGVGNKGNTDVRFAVPDNMTVKQAQAKCGDQAQLSCCNKAVYA
GDTTDINSGILGGTLSNLIGSGSGASGLGLFDQCSKLDLQIPVLIGVPIQDLINQKCKQNIACCQNSPSSANSDL
IGLGLPCVALGSIL*
Coding >Pro_DTO377G3_2|g3485.t1
ATGCAGTTCTCTCTCTCCGCCATTGTCCTCGGCCTCGCTGCCACTGTCTACGCTCTTCCCCCTGGAGGCGCCTCC
GCTGGTGGTGCTGGCTCCGGCAACGGTGTCGGCAACAAGGGCAACACCGACGTTCGCTTCGCTGTCCCCGACAAC
ATGACTGTCAAGCAGGCTCAGGCCAAGTGTGGTGACCAGGCCCAGCTCTCTTGCTGCAACAAGGCTGTCTACGCC
GGTGACACCACCGACATCAACTCCGGAATCCTCGGTGGTACCCTCAGCAACCTGATCGGCTCCGGATCCGGTGCT
TCTGGCCTCGGTCTCTTCGACCAGTGCTCCAAGCTGGATCTCCAGATCCCCGTCCTCATTGGTGTCCCCATCCAG
GATCTCATCAACCAGAAGTGCAAGCAGAACATTGCCTGCTGCCAGAACTCTCCTTCCAGCGCCAACTCCGACCTC
ATCGGTCTCGGCCTCCCCTGTGTTGCCCTTGGCTCCATCCTCTAA
Transcript >Pro_DTO377G3_2|g3485.t1
ATGCAGTTCTCTCTCTCCGCCATTGTCCTCGGCCTCGCTGCCACTGTCTACGCTCTTCCCCCTGGAGGCGCCTCC
GCTGGTGGTGCTGGCTCCGGCAACGGTGTCGGCAACAAGGGCAACACCGACGTTCGCTTCGCTGTCCCCGACAAC
ATGACTGTCAAGCAGGCTCAGGCCAAGTGTGGTGACCAGGCCCAGCTCTCTTGCTGCAACAAGGCTGTCTACGCC
GGTGACACCACCGACATCAACTCCGGAATCCTCGGTGGTACCCTCAGCAACCTGATCGGCTCCGGATCCGGTGCT
TCTGGCCTCGGTCTCTTCGACCAGTGCTCCAAGCTGGATCTCCAGATCCCCGTCCTCATTGGTGTCCCCATCCAG
GATCTCATCAACCAGAAGTGCAAGCAGAACATTGCCTGCTGCCAGAACTCTCCTTCCAGCGCCAACTCCGACCTC
ATCGGTCTCGGCCTCCCCTGTGTTGCCCTTGGCTCCATCCTCTAA
Gene >Pro_DTO377G3_2|g3485.t1
ATGCAGTTCTCTCTCTCCGCCATTGTCCTCGGCCTCGCTGCCACTGTCTACGCTCTTCCCCCTGGAGGCGCCTCC
GCTGGTGGTGCTGGCTCCGGCAACGGTGTCGGCAACAAGGGCAACACCGACGTTCGCTTCGCTGTCCCCGACAAC
ATGACTGTCAAGCAGGCTCAGGCCAAGTGTGGTGACCAGGCCCAGCTCTCTTGCTGCAACAAGGCTGTCTACGCC
GGTGACACCACCGACATCAACTCCGGAATCCTCGGTGGTACCCTCAGCAACCTGATCGGCTCCGGATCCGGTGCT
TCTGGCCTCGGTCTCTTCGACCAGTGCTCCAAGCTGGATCTCCAGATCCCCGTCCTCATTGGTGTCCCCATCCAG
GATCTCATCAACCAGAAGTGCAAGCAGAACATTGCCTGCTGCCAGAACTCTCCTTCCAGCGCCGTTAGTGCTCCA
ACATCCACGCTATTTCGACTACAACTGACATATCTTACAGAACTCCGACCTCATCGGTCTCGGCCTCCCCTGTGT
TGCCCTTGGCTCCATCCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail