Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3464.t1
Gene name
Locationscaffold_05:750889..753055
Strand-
Gene length (bp)2166
Transcript length (bp)2052
Coding sequence length (bp)2052
Protein length (aa) 684

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01179 Cu_amine_oxid Copper amine oxidase, enzyme domain 1.8E-157 238 651
PF02728 Cu_amine_oxidN3 Copper amine oxidase, N3 domain 8.3E-23 111 212
PF02727 Cu_amine_oxidN2 Copper amine oxidase, N2 domain 3.6E-14 21 104

GO

GO Term Description Terminal node
GO:0048038 quinone binding Yes
GO:0008131 primary amine oxidase activity Yes
GO:0009308 amine metabolic process Yes
GO:0005507 copper ion binding Yes
GO:0046914 transition metal ion binding No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0016641 oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors No
GO:0043169 cation binding No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3464.t1
MVLDRLHQLTHQVSATAPPPHPLDPLSTVEIDAAVNIVRKEHGSLNFNAVTLYEPRKAQMMAWVADPENAPRPSR
AADIVAIAPGGKIYDGVVDLDQKKIIKWQHTPNVQPLITMEDLQEVEHVVRKDAKVIEQCGIIGIPKEDMHKVYC
DPWTIGYDERFGTGVRLQQALMYYRPHPDDSQYTYPLDFCPIFNAETKQIIHIDVPSVRRPLSKAPPNNYHPASI
EKEGGYRTDLKPIHITQPEGVSFEVKGRIIEWQNWNIHVGFNYREGIVLNNITFNDKGNVRPVFWRLSMAEMVVP
YGNPEHPHQRKHAFDLGEYGGGYMTNSLTLGCDCKGAIHYMDAAFVNRAGASTIIKNAICIHEEDAGILFKHTDF
RDESMVVTRGRKLIISQIFTAANYEYCVYWIFHQDGTIQLEIKLTGILNTYAMNPGEDTKGWGTEVYPGVNAHNH
QHLFCLRVDPNIDGPNNTVFQVDAVQGPGEVGSAENKYGNAFYAKKTKFSTPIEAMSDYNGSTSRSWDMANTNKL
NPYSKKPVSYKLVSRDVPPLLPKAGSLVWKRAGFARHAVHVTKYDDDQVHPAGRHVPQTSGEPSEGLPAWIEAAG
PSCSIDNTDVVLWHTFGLTHFPAPEDYPIMPAEPMTLLLRPRHFFDRNPVLDVPPSFARTPTQVAANASTCACKK
NDGSSVLV*
Coding >Pro_DTO377G3_2|g3464.t1
ATGGTTCTCGACCGACTACACCAATTGACTCACCAGGTCAGCGCTACTGCACCGCCACCTCATCCACTTGATCCT
CTGTCTACGGTGGAAATTGATGCGGCTGTCAACATTGTCCGCAAAGAACATGGCTCGCTCAACTTCAATGCGGTC
ACACTATACGAGCCCCGCAAGGCCCAGATGATGGCCTGGGTGGCTGATCCAGAAAATGCGCCTCGTCCTAGCCGA
GCCGCTGATATTGTTGCCATTGCGCCTGGTGGTAAGATCTACGATGGTGTGGTTGACCTGGACCAGAAGAAGATC
ATCAAGTGGCAGCACACACCGAATGTTCAGCCTCTGATCACTATGGAGGATTTGCAGGAGGTTGAGCATGTTGTA
CGCAAGGATGCTAAGGTCATCGAGCAATGTGGTATCATTGGAATTCCCAAGGAGGATATGCATAAAGTATACTGT
GACCCATGGACAATTGGATATGATGAGCGCTTTGGAACTGGTGTCCGTCTTCAGCAAGCCCTGATGTACTATCGC
CCTCACCCAGACGACTCCCAATATACCTATCCCTTGGACTTCTGTCCCATCTTCAACGCCGAGACCAAGCAGATC
ATCCACATTGATGTGCCGTCTGTGCGAAGACCGCTCAGCAAGGCGCCTCCAAACAACTACCACCCGGCCTCGATC
GAAAAAGAAGGAGGATACCGAACCGATCTTAAGCCAATTCACATCACCCAGCCAGAGGGTGTGTCTTTCGAGGTC
AAAGGACGCATAATCGAATGGCAGAACTGGAATATCCACGTCGGCTTCAACTACCGGGAAGGAATTGTCCTGAAC
AACATCACATTCAACGACAAGGGCAATGTGCGGCCTGTATTCTGGCGTCTTTCAATGGCCGAGATGGTCGTGCCA
TACGGCAACCCGGAGCATCCCCACCAACGCAAGCATGCATTTGACCTGGGCGAGTACGGCGGTGGATACATGACA
AACAGCCTGACATTGGGATGCGACTGCAAGGGCGCAATCCACTACATGGACGCAGCATTCGTCAACCGGGCGGGC
GCTAGCACAATCATCAAGAACGCCATCTGCATCCACGAAGAAGATGCCGGCATCCTATTCAAGCACACCGATTTC
CGCGACGAGTCGATGGTCGTAACCCGCGGCCGCAAGCTCATCATCTCGCAGATCTTTACCGCAGCAAATTACGAG
TACTGCGTGTACTGGATCTTCCACCAGGACGGCACAATCCAGCTCGAGATCAAGCTGACCGGCATCCTCAACACT
TACGCCATGAACCCAGGCGAGGATACCAAGGGCTGGGGAACCGAGGTGTACCCCGGCGTCAACGCCCATAACCAC
CAGCACCTGTTCTGTCTCCGTGTAGACCCGAACATCGACGGGCCGAACAATACCGTCTTCCAGGTAGACGCAGTC
CAAGGACCCGGTGAAGTCGGCAGTGCCGAGAACAAGTACGGCAACGCCTTCTACGCCAAAAAGACAAAGTTCTCC
ACACCCATCGAGGCTATGTCCGACTATAACGGGTCTACCAGCCGTTCTTGGGACATGGCCAATACCAACAAGCTC
AACCCATACAGCAAGAAGCCCGTCAGCTACAAGCTAGTCAGCCGCGATGTTCCTCCCCTTCTCCCCAAGGCCGGC
AGCCTGGTCTGGAAGCGAGCAGGCTTCGCACGCCATGCTGTCCATGTCACCAAATATGACGACGACCAAGTCCAC
CCAGCTGGCCGCCACGTCCCCCAGACCTCCGGTGAGCCTTCGGAGGGTCTGCCGGCGTGGATCGAAGCTGCTGGC
CCCAGCTGCTCTATTGATAACACCGACGTCGTGCTCTGGCATACTTTCGGTCTGACGCACTTCCCTGCGCCGGAG
GACTACCCGATTATGCCTGCAGAGCCGATGACACTTCTGCTGCGCCCGCGTCACTTCTTTGACCGCAATCCTGTT
CTCGATGTGCCTCCTAGCTTTGCGCGCACACCCACGCAGGTGGCTGCTAATGCGAGCACATGTGCCTGCAAGAAG
AATGATGGCTCCAGTGTTTTGGTTTGA
Transcript >Pro_DTO377G3_2|g3464.t1
ATGGTTCTCGACCGACTACACCAATTGACTCACCAGGTCAGCGCTACTGCACCGCCACCTCATCCACTTGATCCT
CTGTCTACGGTGGAAATTGATGCGGCTGTCAACATTGTCCGCAAAGAACATGGCTCGCTCAACTTCAATGCGGTC
ACACTATACGAGCCCCGCAAGGCCCAGATGATGGCCTGGGTGGCTGATCCAGAAAATGCGCCTCGTCCTAGCCGA
GCCGCTGATATTGTTGCCATTGCGCCTGGTGGTAAGATCTACGATGGTGTGGTTGACCTGGACCAGAAGAAGATC
ATCAAGTGGCAGCACACACCGAATGTTCAGCCTCTGATCACTATGGAGGATTTGCAGGAGGTTGAGCATGTTGTA
CGCAAGGATGCTAAGGTCATCGAGCAATGTGGTATCATTGGAATTCCCAAGGAGGATATGCATAAAGTATACTGT
GACCCATGGACAATTGGATATGATGAGCGCTTTGGAACTGGTGTCCGTCTTCAGCAAGCCCTGATGTACTATCGC
CCTCACCCAGACGACTCCCAATATACCTATCCCTTGGACTTCTGTCCCATCTTCAACGCCGAGACCAAGCAGATC
ATCCACATTGATGTGCCGTCTGTGCGAAGACCGCTCAGCAAGGCGCCTCCAAACAACTACCACCCGGCCTCGATC
GAAAAAGAAGGAGGATACCGAACCGATCTTAAGCCAATTCACATCACCCAGCCAGAGGGTGTGTCTTTCGAGGTC
AAAGGACGCATAATCGAATGGCAGAACTGGAATATCCACGTCGGCTTCAACTACCGGGAAGGAATTGTCCTGAAC
AACATCACATTCAACGACAAGGGCAATGTGCGGCCTGTATTCTGGCGTCTTTCAATGGCCGAGATGGTCGTGCCA
TACGGCAACCCGGAGCATCCCCACCAACGCAAGCATGCATTTGACCTGGGCGAGTACGGCGGTGGATACATGACA
AACAGCCTGACATTGGGATGCGACTGCAAGGGCGCAATCCACTACATGGACGCAGCATTCGTCAACCGGGCGGGC
GCTAGCACAATCATCAAGAACGCCATCTGCATCCACGAAGAAGATGCCGGCATCCTATTCAAGCACACCGATTTC
CGCGACGAGTCGATGGTCGTAACCCGCGGCCGCAAGCTCATCATCTCGCAGATCTTTACCGCAGCAAATTACGAG
TACTGCGTGTACTGGATCTTCCACCAGGACGGCACAATCCAGCTCGAGATCAAGCTGACCGGCATCCTCAACACT
TACGCCATGAACCCAGGCGAGGATACCAAGGGCTGGGGAACCGAGGTGTACCCCGGCGTCAACGCCCATAACCAC
CAGCACCTGTTCTGTCTCCGTGTAGACCCGAACATCGACGGGCCGAACAATACCGTCTTCCAGGTAGACGCAGTC
CAAGGACCCGGTGAAGTCGGCAGTGCCGAGAACAAGTACGGCAACGCCTTCTACGCCAAAAAGACAAAGTTCTCC
ACACCCATCGAGGCTATGTCCGACTATAACGGGTCTACCAGCCGTTCTTGGGACATGGCCAATACCAACAAGCTC
AACCCATACAGCAAGAAGCCCGTCAGCTACAAGCTAGTCAGCCGCGATGTTCCTCCCCTTCTCCCCAAGGCCGGC
AGCCTGGTCTGGAAGCGAGCAGGCTTCGCACGCCATGCTGTCCATGTCACCAAATATGACGACGACCAAGTCCAC
CCAGCTGGCCGCCACGTCCCCCAGACCTCCGGTGAGCCTTCGGAGGGTCTGCCGGCGTGGATCGAAGCTGCTGGC
CCCAGCTGCTCTATTGATAACACCGACGTCGTGCTCTGGCATACTTTCGGTCTGACGCACTTCCCTGCGCCGGAG
GACTACCCGATTATGCCTGCAGAGCCGATGACACTTCTGCTGCGCCCGCGTCACTTCTTTGACCGCAATCCTGTT
CTCGATGTGCCTCCTAGCTTTGCGCGCACACCCACGCAGGTGGCTGCTAATGCGAGCACATGTGCCTGCAAGAAG
AATGATGGCTCCAGTGTTTTGGTTTGA
Gene >Pro_DTO377G3_2|g3464.t1
ATGGTTCTCGACCGACTACACCAATTGACTCACCAGGTCAGCGCTACTGCACCGCCACCTCATCCACTTGATCCT
CTGTCTACGGTGGAAATTGATGCGGCTGTCAACATTGTCCGCAAAGAACATGGCTCGCTCAACTTCAATGCGGTC
ACACTATACGAGCCCCGCAAGGCCCAGATGATGGCCTGGGTGGCTGATCCAGAAAATGCGCCTCGTCCTAGCCGA
GCCGCTGATATTGTTGCCATTGCGCCTGGTGGTAAGATCTACGATGGTGTGGTTGACCTGGACCAGAAGAAGATC
ATCAAGTGGCAGCACACACCGAATGTTCAGCCTCTGATCACTATGGAGGATTTGCAGGAGGTTGAGCATGTTGTA
CGCAAGGATGCTAAGGTCATCGAGCAATGTGGTATCATTGGAATTCCCAAGGAGGATATGCATAAAGTATACTGT
GACCGTAAGTGGACTTCCCTCGTTTGTCAAAGATTGATATTGACCAAATGGTATTATAGCATGGACAATTGGATA
TGATGAGCGCTTTGGAACTGGTGTCCGTCTTCAGCAAGCCCTGATGTACTATCGCCCTCACCCAGACGACTCCCA
ATATACCTATCCCTTGGACTTCTGTCCCATCTTCAACGCCGAGACCAAGCAGATCATCCACATTGATGTGCCGTC
TGTGCGAAGACCGCTCAGCAAGGCGCCTCCAAACAACTACCACCCGGCCTCGATCGAAAAAGAAGGAGGATACCG
AACCGATCTTAAGCCAATTCACATCACCCAGCCAGAGGGTGTGTCTTTCGAGGTCAAAGGACGCATAATCGAATG
GCAGAACTGGAATATCCACGTCGGCTTCAACTACCGGGAAGGAATTGTCCTGAACAACATCACATTCAACGACAA
GGGCAATGTGCGGCCTGTATTCTGGCGTCTTTCAATGGCCGAGATGGTCGTGCCATACGGCAACCCGGAGCATCC
CCACCAACGCAAGCATGCATTTGACCTGGGCGAGTACGGCGGTGGATACATGACAAACAGCCTGACATTGGGATG
CGACTGCAAGGGCGCAATCCACTACATGGACGCAGCATTCGTCAACCGGGCGGGCGCTAGCACAATCATCAAGAA
CGCCATCTGCATCCACGAAGAAGATGCCGGCATCCTATTCAAGCACACCGATTTCCGCGACGAGTCGATGGTCGT
AACCCGCGGCCGCAAGCTCATCATCTCGCAGATCTTTACCGCAGCAAATTACGAGTACTGCGTGTACTGGATCTT
CCACCAGGACGGCACAATCCAGCTCGAGATCAAGCTGACCGGCATCCTCAACACTTACGCCATGAACCCAGGCGA
GGATACCAAGGGCTGGGGAACCGAGGTGTACCCCGGCGTCAACGCCCATAACCACCAGCACCTGTTCTGTCTCCG
TGTAGACCCGAACATCGACGGGCCGAACAATACCGTCTTCCAGGTAGACGCAGTCCAAGGACCCGGTGAAGTCGG
CAGTGCCGAGAACAAGTACGGCAACGCCTTCTACGCCAAAAAGACAAAGTTCTCCACACCCATCGAGGCTATGTC
CGACTATAACGGGTCTACCAGCCGTTCTTGGGACATGGCCAATACCAACAAGCTCAACCCATACAGCAAGAAGCC
CGTCAGCTACAAGCTAGTCAGCCGCGATGTTCCTCCCCTTCTCCCCAAGGCCGGCAGCCTGGTCTGGAAGCGAGC
AGGCTTCGCACGCCATGCTGTCCATGTCACCAAATGTGAGTTTTGCAATTTCCCCCTTCTGATATCGTGTTCCTT
TTCTGACTTCATTCTCTAGATGACGACGACCAAGTCCACCCAGCTGGCCGCCACGTCCCCCAGACCTCCGGTGAG
CCTTCGGAGGGTCTGCCGGCGTGGATCGAAGCTGCTGGCCCCAGCTGCTCTATTGATAACACCGACGTCGTGCTC
TGGCATACTTTCGGTCTGACGCACTTCCCTGCGCCGGAGGACTACCCGATTATGCCTGCAGAGCCGATGACACTT
CTGCTGCGCCCGCGTCACTTCTTTGACCGCAATCCTGTTCTCGATGTGCCTCCTAGCTTTGCGCGCACACCCACG
CAGGTGGCTGCTAATGCGAGCACATGTGCCTGCAAGAAGAATGATGGCTCCAGTGTTTTGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail