Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3459.t1
Gene name
Locationscaffold_05:742914..744165
Strand-
Gene length (bp)1251
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 3.6E-26 6 124
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 3.6E-14 138 248
PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain 2.0E-05 29 122

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050661 NADP binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0050662 coenzyme binding No
GO:0048037 cofactor binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3459.t1
MAKTYNVGIVGYGFSAKIFHIPFVTEVPELKLYAVVQRTPKQDDDAEKDHPGVKSYRSAEEMVQDPAVDVVIITT
APDSHFALSKLALEAGKHVVCEKPFTPTSKEADELVALAKKNNKQLAVYQNRRFDADYVTLSKLVKNGSFGRISE
FETHFDRHRPEEPANSTSWKNKVIPGGSAIYDLGTHLLDQVVHLLGLPARVTAFIGSAREHNTTSYEDSFTVLLH
YANGSMVTAKATVVSPEEEQLRFWVRGTEGSFKKYHLDIQEDQLKAGIKPQDKGYGREPSERYGTLTTIKDGNPV
KEVVPTVEPPTYTEYYRKLVRGLGGEGDLPASGAEAAQVIRLIELARESSSVGRTLDV*
Coding >Pro_DTO377G3_2|g3459.t1
ATGGCTAAGACTTACAACGTCGGTATTGTCGGCTACGGCTTCAGCGCGAAGATCTTCCACATTCCCTTCGTGACG
GAGGTTCCCGAGCTCAAGCTCTACGCAGTTGTCCAGCGCACACCGAAGCAGGATGACGATGCCGAGAAGGACCAC
CCCGGTGTGAAGTCGTACCGTAGCGCTGAGGAGATGGTCCAGGACCCCGCAGTCGACGTGGTGATCATCACTACT
GCCCCCGACTCTCACTTCGCACTGTCCAAGCTGGCACTGGAGGCTGGCAAGCACGTTGTCTGCGAGAAGCCCTTC
ACCCCCACTTCCAAGGAAGCGGATGAACTCGTCGCCCTTGCAAAGAAGAACAACAAACAGCTTGCCGTATACCAG
AATCGCCGCTTCGATGCCGACTACGTGACCCTCTCCAAGCTCGTCAAGAACGGCTCATTCGGCCGCATCTCCGAG
TTTGAAACCCACTTCGACCGTCACCGTCCAGAGGAGCCGGCCAACTCTACCTCATGGAAGAACAAGGTCATCCCT
GGTGGCTCAGCGATCTATGACCTTGGAACCCACCTCCTTGATCAGGTCGTGCATCTGCTCGGACTGCCCGCACGA
GTAACCGCTTTCATTGGCTCCGCCCGGGAGCACAACACGACTTCATACGAGGACTCCTTCACCGTTCTGCTGCAC
TATGCCAACGGCAGTATGGTTACCGCCAAGGCGACTGTGGTCAGCCCCGAGGAAGAGCAGCTGCGCTTCTGGGTG
CGCGGTACCGAGGGTAGCTTCAAGAAGTACCACCTCGATATCCAAGAAGATCAGCTCAAGGCCGGCATCAAGCCC
CAGGATAAGGGATACGGTCGTGAGCCCAGTGAGCGTTACGGTACTCTGACAACCATCAAGGACGGCAACCCCGTC
AAGGAGGTGGTTCCCACCGTCGAGCCCCCCACTTACACCGAGTACTACCGCAAGCTTGTTCGCGGTCTTGGTGGC
GAGGGTGACCTTCCTGCTAGCGGCGCGGAGGCTGCTCAGGTCATTCGTTTGATCGAGTTGGCTCGTGAGAGTTCC
AGCGTTGGACGTACTTTGGACGTCTAA
Transcript >Pro_DTO377G3_2|g3459.t1
ATGGCTAAGACTTACAACGTCGGTATTGTCGGCTACGGCTTCAGCGCGAAGATCTTCCACATTCCCTTCGTGACG
GAGGTTCCCGAGCTCAAGCTCTACGCAGTTGTCCAGCGCACACCGAAGCAGGATGACGATGCCGAGAAGGACCAC
CCCGGTGTGAAGTCGTACCGTAGCGCTGAGGAGATGGTCCAGGACCCCGCAGTCGACGTGGTGATCATCACTACT
GCCCCCGACTCTCACTTCGCACTGTCCAAGCTGGCACTGGAGGCTGGCAAGCACGTTGTCTGCGAGAAGCCCTTC
ACCCCCACTTCCAAGGAAGCGGATGAACTCGTCGCCCTTGCAAAGAAGAACAACAAACAGCTTGCCGTATACCAG
AATCGCCGCTTCGATGCCGACTACGTGACCCTCTCCAAGCTCGTCAAGAACGGCTCATTCGGCCGCATCTCCGAG
TTTGAAACCCACTTCGACCGTCACCGTCCAGAGGAGCCGGCCAACTCTACCTCATGGAAGAACAAGGTCATCCCT
GGTGGCTCAGCGATCTATGACCTTGGAACCCACCTCCTTGATCAGGTCGTGCATCTGCTCGGACTGCCCGCACGA
GTAACCGCTTTCATTGGCTCCGCCCGGGAGCACAACACGACTTCATACGAGGACTCCTTCACCGTTCTGCTGCAC
TATGCCAACGGCAGTATGGTTACCGCCAAGGCGACTGTGGTCAGCCCCGAGGAAGAGCAGCTGCGCTTCTGGGTG
CGCGGTACCGAGGGTAGCTTCAAGAAGTACCACCTCGATATCCAAGAAGATCAGCTCAAGGCCGGCATCAAGCCC
CAGGATAAGGGATACGGTCGTGAGCCCAGTGAGCGTTACGGTACTCTGACAACCATCAAGGACGGCAACCCCGTC
AAGGAGGTGGTTCCCACCGTCGAGCCCCCCACTTACACCGAGTACTACCGCAAGCTTGTTCGCGGTCTTGGTGGC
GAGGGTGACCTTCCTGCTAGCGGCGCGGAGGCTGCTCAGGTCATTCGTTTGATCGAGTTGGCTCGTGAGAGTTCC
AGCGTTGGACGTACTTTGGACGTCTAA
Gene >Pro_DTO377G3_2|g3459.t1
ATGGCTAAGACTTACAACGTCGGTATTGTCGGCTACGGCTTCAGCGCGAAGATCTTCCACATTCCCTTCGTGACG
GAGGTTCCCGAGCTCAAGCTCTACGCAGTTGTCCAGCGCACACCGAAGCAGGATGACGATGCCGAGAAGGACCAC
CCCGGTGTGAAGTCGTACCGTAGCGCTGAGGAGATGGTCCAGGACCCCGCAGTCGACGTGGTGATCATCACTACT
GCCCCCGACTCTCACTTCGCACTGTCCAAGCTGGCACTGGAGGCTGGCAAGCACGGTAGATGCCCAGAAATCCCG
GATATCAGTTGGTATATATACTAACGTGGAATAATCAGTTGTCTGCGAGAAGCCCTTCACCCCCACTTCCAAGGA
AGCGGATGAACTCGTCGCCCTTGCAAAGAAGAACAACAAACAGCTTGCCGTATACCAGAGTATGTCTCGTCACCT
AGCTTATCCAAACCTCTACTAATACCTGCCTAGATCGCCGCTTCGATGCCGACTACGTGACCCTCTCCAAGCTCG
TCAAGAACGGCTCATTCGGCCGCATCTCCGAGTTTGAAACCCACTTCGACCGTCACCGTCCAGAGGAGCCGGCCA
ACTCTACCTCATGGAAGAACAAGGTCATCCCTGGTGGCTCAGCGATCTATGACCTTGGAACCCACCTCCTTGATC
AGGTCGTGCATCTGCTCGGACTGCCCGCACGAGTAACCGCTTTCATTGGCTCCGCCCGGGAGCACAACACGACTT
CATACGAGGACTCCTTCACCGTTCTGCTGCACTATGCCAACGGCAGTATGGTTACCGCCAAGGCGACTGTGGTCA
GCCCCGAGGAAGAGCAGCTGCGCTTCTGGGTGCGCGGTACCGAGGGTAGCTTCAAGAAGGTGAGAGCAATCTACT
CACGTAGATCACTGCGATGTAAAGAAATGTGAATGCTGACCTAATTGATAGTACCACCTCGATATCCAAGAAGAT
CAGCTCAAGGCCGGCATCAAGCCCCAGGATAAGGGATACGGTCGTGAGCCCAGTGAGCGTTACGGTACTCTGACA
ACCATCAAGGACGGCAACCCCGTCAAGGAGGTGGTTCCCACCGTCGAGCCCCCCACTTACACCGAGTACTACCGC
AAGCTTGTTCGCGGTCTTGGTGGCGAGGGTGACCTTCCTGCTAGCGGCGCGGAGGCTGCTCAGGTCATTCGTTTG
ATCGAGTTGGCTCGTGAGAGTTCCAGCGTTGGACGTACTTTGGACGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail