Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3452.t1
Gene name
Locationscaffold_05:731050..732612
Strand-
Gene length (bp)1562
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00004 AAA ATPase family associated with various cellular activities (AAA) 6.8E-40 245 377
PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain 2.1E-11 132 186
PF17862 AAA_lid_3 AAA+ lid domain 9.3E-11 400 444
PF05673 DUF815 Protein of unknown function (DUF815) 2.2E-05 240 310

GO

GO Term Description Terminal node
GO:0016887 ATP hydrolysis activity Yes
GO:0005524 ATP binding Yes
GO:0005488 binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016462 pyrophosphatase activity No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 166.45 101.55 231.36
5d_25C Five days - 25 degrees Celsius 155.13 94.80 215.45
7d_25C Seven days - 25 degrees Celsius 149.34 91.09 207.58
10d_25C Ten days - 25 degrees Celsius 161.04 98.26 223.82
7d_15C Seven days - 15 degrees Celsius 187.57 113.77 261.37
7d_30C Seven days - 30 degrees Celsius 143.90 87.74 200.05

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.818281 no
3d_25C 7d_25C 0.700509 no
3d_25C 7d_15C 0.663407 no
3d_25C 7d_30C 0.583201 no
3d_25C 10d_25C 0.921698 no
5d_25C 7d_25C 0.909083 no
5d_25C 7d_15C 0.440740 no
5d_25C 7d_30C 0.804910 no
5d_25C 10d_25C 0.910799 no
7d_25C 7d_15C 0.333823 no
7d_25C 7d_30C 0.915533 no
7d_25C 10d_25C 0.805733 no
7d_15C 7d_30C 0.251689 no
7d_15C 10d_25C 0.560134 no
7d_30C 10d_25C 0.691119 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3452.t1
MGQQQSNLGGGPGGPGGDDKDKKKEKPKYEPPPPPTTRLGKKKRKAAGPSTASKLPDIYPTSRCKLRYLRMQRVH
DHLLLEEEYVENMERMRKAKALATQDPARGGSDLDVMDRNADERSRVDDMRGSPMGVGNLEELIDDDHAIVSSAT
GPEYYVSIMSFVDKDLLEPGASILLHHKSVSVVGVLTEESDPLVSVMKLDKAPTESYADIGGLEQQIQEVRESVE
LPLLHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFSVAADH
APSIVFIDEIDAIGTKRYDSQSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKIL
FENPDQNTKKKIFTLHTSKMSLSDDVDLEEFINQKDDLSGADIRAICTEAGLMALRERRMRVQMEDFRAARERIM
KTKQDGGPVEGLYL*
Coding >Pro_DTO377G3_2|g3452.t1
ATGGGTCAACAACAGTCTAATCTGGGCGGCGGCCCTGGAGGCCCTGGAGGCGATGACAAGGATAAGAAGAAGGAG
AAGCCCAAATACGAACCTCCCCCACCACCTACCACTCGTCTTGGAAAGAAGAAGCGCAAGGCTGCCGGCCCAAGC
ACTGCGTCCAAGCTCCCGGATATCTACCCTACATCGCGATGCAAGCTACGATACCTTCGCATGCAGCGTGTTCAC
GACCACTTGCTGTTAGAAGAAGAGTACGTTGAGAACATGGAACGCATGCGCAAGGCCAAGGCTCTGGCCACGCAA
GATCCCGCTAGAGGGGGTAGTGACTTGGATGTGATGGATCGGAACGCTGATGAGCGGAGCCGAGTCGATGACATG
CGAGGCAGCCCGATGGGCGTCGGCAACTTAGAAGAGTTGATTGATGATGACCATGCTATTGTCTCAAGTGCCACC
GGCCCTGAATACTACGTCTCGATCATGTCTTTCGTCGATAAAGATCTTCTCGAGCCGGGTGCCAGTATTCTCCTG
CACCACAAGTCAGTGTCTGTCGTCGGTGTACTGACGGAGGAGTCTGACCCCCTTGTCTCGGTCATGAAGTTGGAC
AAGGCGCCGACAGAGTCATACGCTGATATTGGTGGTCTGGAGCAGCAAATCCAGGAAGTTAGAGAATCCGTGGAG
CTGCCCTTGCTACACCCCGAGCTTTATGAAGAGATGGGTATCAAGCCCCCGAAGGGAGTGATTCTTTACGGTGCC
CCAGGTACCGGAAAGACGCTACTTGCTAAGGCTGTTGCCAACCAGACCAGCGCAACCTTCCTCCGCATTGTTGGC
AGTGAGCTGATTCAGAAGTATCTGGGTGATGGCCCACGCCTGGTTCGCCAGATCTTCTCCGTTGCTGCTGACCAT
GCCCCATCAATCGTTTTCATTGACGAGATTGATGCTATCGGTACGAAGCGATACGACTCACAATCCGGCGGAGAG
CGAGAAATCCAGCGAACCATGCTGGAGCTTTTGAACCAGCTGGATGGATTCGATGATCGTGGTGACGTGAAGGTC
ATTATGGCCACCAACAAAATCGAAACACTGGACCCAGCTTTGATCCGACCTGGTCGTATTGATCGTAAGATTCTC
TTCGAGAATCCAGACCAAAACACCAAGAAGAAGATTTTCACTCTGCACACATCAAAGATGTCTCTCAGTGATGAC
GTTGATCTCGAGGAATTCATCAACCAGAAGGATGATCTCTCTGGTGCTGACATCCGCGCTATCTGTACCGAAGCT
GGTTTGATGGCCTTGAGAGAGCGCCGAATGAGGGTGCAGATGGAAGATTTCCGGGCTGCTCGTGAGCGTATCATG
AAGACCAAGCAGGACGGTGGTCCTGTGGAGGGTCTATACTTGTAA
Transcript >Pro_DTO377G3_2|g3452.t1
ATGGGTCAACAACAGTCTAATCTGGGCGGCGGCCCTGGAGGCCCTGGAGGCGATGACAAGGATAAGAAGAAGGAG
AAGCCCAAATACGAACCTCCCCCACCACCTACCACTCGTCTTGGAAAGAAGAAGCGCAAGGCTGCCGGCCCAAGC
ACTGCGTCCAAGCTCCCGGATATCTACCCTACATCGCGATGCAAGCTACGATACCTTCGCATGCAGCGTGTTCAC
GACCACTTGCTGTTAGAAGAAGAGTACGTTGAGAACATGGAACGCATGCGCAAGGCCAAGGCTCTGGCCACGCAA
GATCCCGCTAGAGGGGGTAGTGACTTGGATGTGATGGATCGGAACGCTGATGAGCGGAGCCGAGTCGATGACATG
CGAGGCAGCCCGATGGGCGTCGGCAACTTAGAAGAGTTGATTGATGATGACCATGCTATTGTCTCAAGTGCCACC
GGCCCTGAATACTACGTCTCGATCATGTCTTTCGTCGATAAAGATCTTCTCGAGCCGGGTGCCAGTATTCTCCTG
CACCACAAGTCAGTGTCTGTCGTCGGTGTACTGACGGAGGAGTCTGACCCCCTTGTCTCGGTCATGAAGTTGGAC
AAGGCGCCGACAGAGTCATACGCTGATATTGGTGGTCTGGAGCAGCAAATCCAGGAAGTTAGAGAATCCGTGGAG
CTGCCCTTGCTACACCCCGAGCTTTATGAAGAGATGGGTATCAAGCCCCCGAAGGGAGTGATTCTTTACGGTGCC
CCAGGTACCGGAAAGACGCTACTTGCTAAGGCTGTTGCCAACCAGACCAGCGCAACCTTCCTCCGCATTGTTGGC
AGTGAGCTGATTCAGAAGTATCTGGGTGATGGCCCACGCCTGGTTCGCCAGATCTTCTCCGTTGCTGCTGACCAT
GCCCCATCAATCGTTTTCATTGACGAGATTGATGCTATCGGTACGAAGCGATACGACTCACAATCCGGCGGAGAG
CGAGAAATCCAGCGAACCATGCTGGAGCTTTTGAACCAGCTGGATGGATTCGATGATCGTGGTGACGTGAAGGTC
ATTATGGCCACCAACAAAATCGAAACACTGGACCCAGCTTTGATCCGACCTGGTCGTATTGATCGTAAGATTCTC
TTCGAGAATCCAGACCAAAACACCAAGAAGAAGATTTTCACTCTGCACACATCAAAGATGTCTCTCAGTGATGAC
GTTGATCTCGAGGAATTCATCAACCAGAAGGATGATCTCTCTGGTGCTGACATCCGCGCTATCTGTACCGAAGCT
GGTTTGATGGCCTTGAGAGAGCGCCGAATGAGGGTGCAGATGGAAGATTTCCGGGCTGCTCGTGAGCGTATCATG
AAGACCAAGCAGGACGGTGGTCCTGTGGAGGGTCTATACTTGTAA
Gene >Pro_DTO377G3_2|g3452.t1
ATGGTGAGTGTTCCTTTGGGAGGTTATCTCGATTTATATTCTAACATTCAAAACTAGGGTCAACAACAGTCTAAT
CTGGGCGGCGGCCCTGGAGGCCCTGGAGGCGATGACAAGGATAAGAAGGTATGTCTCCAACTCATTTCCACTGCT
ACACCCAGCGCTAAGACCATATCTCTTTTATCAGAAGGAGAAGCCCAAATACGAACCTCCCCCACCACCTACCAC
TCGTCTTGGAAAGAAGAAGCGCAAGGCTGCCGGCCCAAGCACTGCGTCCAAGCTCCCGGATATCTACCCTACATC
GCGATGCAAGCTACGATACCTTCGCATGCAGCGTGTTCACGACCACTTGCTGTTAGAAGAAGAGTACGTTGAGAA
CATGGAACGCATGCGCAAGGCCAAGGCTCTGGCCACGCAAGATCCCGCTAGAGGGGGTAGTGACTTGGATGTGAT
GGATCGGAACGCTGATGAGCGGAGCCGAGTCGATGACATGCGAGGCAGCCCGATGGGCGTCGGCAACTTAGAAGA
GTTGATTGATGATGACCATGCTATTGTCTCAAGTGCCACCGGCCCTGAATACTACGTCTCGATCATGTCTTTCGT
CGATAAAGATCTTCTCGAGCCGGGTGCCAGTATTCTCCTGCACCACAAGTCAGTGTCTGTCGTCGGTGTACTGAC
GGAGGAGTCTGACCCCCTTGTCTCGGTCATGAAGTTGGACAAGGCGCCGACAGAGTCATACGCTGATATTGGTGG
TCTGGAGCAGCAAATCCAGGAAGTTAGAGAATCCGTGGAGCTGCCCTTGCTACACCCCGAGCTTTATGAAGAGAT
GGGTATCAAGCCCCCGAAGGGAGTGATTCTTTACGGTGCCCCAGGTACCGGAAAGACGCTACTTGCTAAGGCTGT
TGCCAACCAGACCAGCGCAACCTTCCTCCGCATTGTTGGCAGTGAGCTGATTCAGAAGTATCTGGGTGATGGCCC
ACGCCTGGTTCGCCAGATCTTCTCCGTTGCTGCTGACCATGCCCCATCAATCGTTTTCATTGACGAGATTGATGC
TATCGGTACGAAGCGATACGACTCACAATCCGGCGGAGAGCGAGAAATCCAGCGAACCATGCTGGAGCTTTTGAA
CCAGCTGGATGGATTCGATGATCGTGGTGACGTGAAGGTCATTATGGCCACCAACAAAATCGAAACACTGGACCC
AGCTTTGATCCGACCTGGTCGTATTGATCGTAAGATTCTCTTCGAGAATCCAGACCGTAAGTGATACCCTAGTAT
CTACTGCTGCGCCAGCTTACTAACAATTCCTAGAAAACACCAAGAAGAAGATTTTCACTCTGCACACATCAAAGA
TGTCTCTCAGTGATGACGTTGATCTCGAGGAATTCATCAACCAGAAGGATGATCTCTCTGGTGCTGACATCCGCG
CTATCTGTACCGAAGCTGGTTTGATGGCCTTGAGAGAGCGCCGAATGAGGGTGCAGATGGAAGATTTCCGGGCTG
CTCGTGAGCGTATCATGAAGACCAAGCAGGACGGTGGTCCTGTGGAGGGTCTATACTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail