Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3447.t1
Gene name
Locationscaffold_05:715318..719179
Strand-
Gene length (bp)3861
Transcript length (bp)3789
Coding sequence length (bp)3789
Protein length (aa) 1263

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16016 VASt VAD1 Analog of StAR-related lipid transfer domain 1.4E-33 887 1035
PF02893 GRAM GRAM domain 4.9E-22 646 753

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 1112 1134 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3447.t1
MADSSSSSFKGENRSRRSWTLSAESSAIGSNGRSSQESTLERPKTQGGEAADPKAGPSGFSKLLDARRRRKEHKK
KQQKQADEPPVPTVVLEQDLHESRSNESRDGTSAAPSSSTDSWVPENEGNNLLTDDSEPDGPPPLTSHDSHTGFY
TSSSPMIKTKSVDTANTEGWHGDAESAVSGSSATGSESNPGDRISRRATSGMALDVPTDSNGKKRSPSPGRRLRG
ASNSDKKGASDDAEASSIKSGSNKSRSLFGGSRRGSLSSKRAQAAPDDVPPLPAPIRTDLTEEKPRALEASPMPN
TPPHTAIPAPETTVTPPTPTEHRPLSAQILSNNVTDSPEPLQENSPGVTIVSPSGNMISHRRVRSASAAHGPSKL
SNSVSALTPLEEKTPGAKNATSNQQSGFFSSVFSVAQNAATSLSNSINAQQRNRPTFQPVPADADKSLNESTSEE
GERTSDNGKTEGRPSAVETLGAGDLNFSHLDIDARPGESITTADGVVITKPVNPADNRKNTAVSRRDEEAAKLED
KRAARAVQVAYERPSELSLTGPAEDALEIESNTSLPKDSLILGDQTPPSGSIIDGDLSGGLGRSGSVRSRLARRH
RGSSGATASTIGAIGANPAALGVPGINSSVPRLTGFAVASKKRNRDFHQLFRSVPEDDYLIEDYSCALQREIILA
GRIYISEGHICFSSNILGWVTTLVISFDEVVAIEKENTAMVFPNAIAIQTLHARHTFRSLLSRESTYDLMVNIWK
INHPTIKSSVNGTRVTHGTGDKTEKVGEDESESESEATDEDEIYDEDEEGENAESFYEGGDSANNSATSLPLQKG
LSRKASNLSTHAAVPVAGTNGNGDKKNGDKGTSKDATPDFPGPTTHAPTEYVEANGQYEKVIKDEIIPAPLGKVF
SLVFGPASGEFMTKFLADNQKCGELQFEGTPKGLTMESPTRKYSYIKPLNGSIGPRQTKCISTETIDLLDLEKAV
LVTLSTQTPDVPSGNVFATMTKYLFTWAPGNQTRFLMTCTIEWSGKSWLKGPIEKGAIDGQTTFGNELVKALQVG
VVPRGRGAGRGKGKRKKGDAAGRESTAAASLKVTVDSNTGNGESWGLFEPVRPLLEPFTSLLSPLWTSNVALLVI
AILFYMAFFRSSPSSSMLSSDVGFPGHSLPQRLAAYEEMWRREETELWNWLEDRVGMDGMVFPNVYRSPEPHPSR
RSSGASILDERELAARLREEKITDREMDHAIRTTRQHLDVLEKMVDKRKAQWEADEPVKSEL*
Coding >Pro_DTO377G3_2|g3447.t1
ATGGCCGACTCTTCGTCTTCAAGCTTTAAAGGCGAGAACAGATCGCGCCGCTCCTGGACATTATCGGCAGAATCA
AGTGCAATCGGTAGCAACGGTCGGTCATCCCAGGAGTCGACCCTCGAGAGACCGAAAACCCAGGGTGGAGAAGCA
GCAGATCCTAAGGCTGGTCCTAGTGGATTCTCAAAGCTACTCGATGCGCGTCGGAGGCGGAAAGAGCATAAAAAA
AAGCAGCAGAAACAAGCCGACGAGCCGCCGGTGCCGACTGTTGTTTTGGAACAAGACCTGCATGAAAGCCGGTCC
AATGAATCTCGCGATGGGACCTCCGCAGCCCCGTCGTCGAGCACAGACAGCTGGGTGCCGGAGAATGAGGGCAAT
AATCTATTGACAGATGATTCCGAGCCGGACGGGCCCCCGCCGCTCACCTCACATGACTCCCATACCGGATTCTAC
ACGTCGTCCTCCCCAATGATCAAGACCAAATCGGTGGATACCGCAAATACGGAAGGATGGCATGGTGATGCCGAG
TCAGCTGTTAGCGGCTCTAGTGCCACCGGGTCAGAATCAAACCCGGGTGATAGAATCTCCCGACGCGCAACATCG
GGTATGGCATTGGATGTCCCTACGGACTCAAATGGCAAGAAACGCAGTCCATCCCCTGGGCGACGCCTGAGAGGC
GCGTCCAATTCAGACAAAAAGGGTGCCAGTGACGACGCTGAGGCTTCATCAATTAAGTCTGGGAGCAACAAAAGC
CGAAGTCTGTTCGGAGGCAGCAGGCGGGGCAGTCTTTCATCAAAACGAGCACAGGCAGCCCCTGACGACGTTCCG
CCTTTGCCTGCGCCAATTCGTACTGATCTAACGGAGGAGAAGCCTCGTGCGCTTGAAGCGAGCCCCATGCCGAAC
ACCCCACCTCATACCGCTATTCCTGCACCAGAGACGACTGTAACCCCTCCAACACCAACTGAGCATCGCCCTCTC
AGTGCACAAATCCTATCTAACAATGTTACCGATTCGCCCGAGCCCCTACAAGAAAATTCTCCCGGTGTTACTATC
GTGAGCCCCTCTGGAAACATGATCTCTCACCGCCGGGTGCGGTCCGCTTCTGCAGCTCATGGCCCAAGCAAATTG
TCCAATTCAGTGTCTGCACTGACACCTCTTGAAGAAAAAACCCCGGGGGCGAAGAATGCAACTTCAAACCAGCAA
AGTGGCTTCTTCTCCTCCGTGTTTTCAGTTGCGCAAAACGCCGCCACTTCCTTAAGCAACAGCATCAACGCACAA
CAGAGAAATCGTCCAACATTTCAACCTGTTCCTGCTGATGCTGATAAATCACTCAATGAATCCACCTCGGAGGAG
GGCGAAAGGACATCGGATAACGGCAAGACTGAAGGGAGACCATCTGCTGTAGAGACTCTTGGGGCAGGAGATCTG
AACTTCAGCCATCTGGACATTGACGCACGACCCGGTGAGTCAATCACGACTGCCGACGGCGTGGTGATTACAAAG
CCAGTGAACCCCGCTGACAACCGCAAAAACACAGCTGTTTCCCGGCGAGATGAGGAAGCGGCTAAACTTGAAGAC
AAACGCGCAGCGCGCGCTGTTCAAGTAGCATACGAAAGACCCTCGGAGCTTTCATTGACGGGCCCTGCGGAAGAC
GCCCTGGAGATTGAGTCTAACACCTCACTTCCGAAAGATAGCTTAATTCTGGGTGATCAAACTCCTCCCAGTGGT
AGTATTATTGACGGTGACCTAAGCGGGGGCCTTGGGCGCTCAGGCAGTGTGCGCAGTAGGCTTGCCCGGCGTCAT
CGGGGCTCATCTGGGGCCACAGCCTCGACGATTGGAGCGATTGGCGCCAACCCCGCTGCCCTTGGTGTTCCTGGC
ATCAACTCCAGTGTGCCTCGGTTGACTGGCTTCGCTGTTGCGAGTAAGAAGCGCAATCGGGACTTTCACCAATTA
TTCCGGAGCGTACCTGAAGACGATTATCTTATCGAAGATTACAGCTGTGCGTTGCAACGTGAGATCATTCTTGCC
GGCCGCATTTATATTTCAGAAGGGCACATCTGTTTCTCTAGTAACATCCTGGGATGGGTCACGACTCTAGTGATC
AGCTTCGATGAGGTTGTTGCTATCGAAAAGGAAAACACGGCCATGGTGTTCCCCAATGCTATTGCCATTCAGACA
CTTCATGCGCGTCACACGTTCCGCAGTTTGCTCAGTCGCGAGTCCACCTATGACCTAATGGTTAATATTTGGAAG
ATCAACCATCCCACCATTAAGAGCTCTGTGAACGGAACCCGCGTAACCCATGGCACCGGTGATAAGACAGAGAAG
GTCGGGGAGGACGAGAGCGAGTCCGAGAGCGAGGCCACCGATGAAGATGAAATATACGACGAGGACGAGGAAGGA
GAGAATGCCGAGAGCTTCTACGAGGGTGGCGACAGCGCCAACAACAGTGCAACATCATTGCCATTGCAAAAAGGA
TTAAGTCGTAAGGCTTCGAATCTATCCACACATGCTGCCGTGCCAGTGGCCGGCACAAATGGCAATGGCGATAAA
AAGAACGGAGACAAGGGAACTTCCAAGGACGCGACTCCTGATTTCCCAGGTCCGACTACACATGCGCCTACCGAG
TACGTCGAAGCCAACGGACAGTACGAAAAAGTCATCAAAGATGAAATAATTCCTGCGCCGCTCGGCAAAGTCTTC
TCTTTGGTTTTTGGCCCAGCGTCGGGCGAATTTATGACCAAGTTCCTTGCCGACAATCAGAAATGTGGAGAGCTA
CAGTTCGAGGGAACACCGAAGGGTTTGACGATGGAAAGCCCAACCAGGAAGTACTCATACATCAAACCTCTCAAT
GGCTCTATCGGTCCGAGGCAGACCAAATGTATCAGCACCGAGACCATAGACTTATTGGACCTTGAAAAGGCCGTT
CTTGTCACCCTGAGCACCCAAACACCCGATGTGCCTAGTGGGAACGTATTTGCTACCATGACCAAGTACCTCTTC
ACATGGGCTCCTGGCAACCAAACTCGCTTCCTCATGACTTGTACTATTGAGTGGTCAGGCAAGAGTTGGCTTAAG
GGTCCTATTGAGAAAGGTGCAATTGATGGGCAAACGACCTTTGGTAATGAGCTGGTCAAAGCCTTGCAGGTTGGT
GTTGTTCCCCGTGGGCGTGGCGCTGGACGAGGCAAAGGAAAGCGCAAGAAGGGCGATGCCGCAGGGCGGGAGTCG
ACCGCAGCTGCTTCGTTGAAGGTTACTGTGGATTCCAACACCGGAAATGGGGAATCATGGGGACTATTCGAACCA
GTCCGCCCACTCCTAGAGCCCTTTACCAGCCTTCTCAGTCCGCTATGGACTAGCAACGTCGCTCTTCTAGTTATC
GCAATCTTGTTCTACATGGCGTTCTTCCGATCCTCGCCGTCGTCGTCCATGCTTTCGTCTGATGTCGGCTTTCCC
GGTCACAGCTTGCCTCAGAGACTGGCCGCATACGAGGAGATGTGGCGACGCGAAGAGACTGAGCTCTGGAATTGG
CTGGAAGACCGGGTTGGCATGGACGGAATGGTATTTCCAAACGTCTACCGGTCGCCCGAGCCACACCCAAGTCGT
AGGTCATCTGGAGCTAGTATACTCGATGAGCGCGAGCTCGCTGCACGGCTTCGCGAAGAGAAGATCACTGACCGT
GAGATGGACCATGCCATTCGCACTACCCGCCAACATCTCGACGTCCTTGAGAAGATGGTGGACAAACGCAAAGCC
CAATGGGAAGCCGATGAACCAGTGAAGTCCGAATTGTGA
Transcript >Pro_DTO377G3_2|g3447.t1
ATGGCCGACTCTTCGTCTTCAAGCTTTAAAGGCGAGAACAGATCGCGCCGCTCCTGGACATTATCGGCAGAATCA
AGTGCAATCGGTAGCAACGGTCGGTCATCCCAGGAGTCGACCCTCGAGAGACCGAAAACCCAGGGTGGAGAAGCA
GCAGATCCTAAGGCTGGTCCTAGTGGATTCTCAAAGCTACTCGATGCGCGTCGGAGGCGGAAAGAGCATAAAAAA
AAGCAGCAGAAACAAGCCGACGAGCCGCCGGTGCCGACTGTTGTTTTGGAACAAGACCTGCATGAAAGCCGGTCC
AATGAATCTCGCGATGGGACCTCCGCAGCCCCGTCGTCGAGCACAGACAGCTGGGTGCCGGAGAATGAGGGCAAT
AATCTATTGACAGATGATTCCGAGCCGGACGGGCCCCCGCCGCTCACCTCACATGACTCCCATACCGGATTCTAC
ACGTCGTCCTCCCCAATGATCAAGACCAAATCGGTGGATACCGCAAATACGGAAGGATGGCATGGTGATGCCGAG
TCAGCTGTTAGCGGCTCTAGTGCCACCGGGTCAGAATCAAACCCGGGTGATAGAATCTCCCGACGCGCAACATCG
GGTATGGCATTGGATGTCCCTACGGACTCAAATGGCAAGAAACGCAGTCCATCCCCTGGGCGACGCCTGAGAGGC
GCGTCCAATTCAGACAAAAAGGGTGCCAGTGACGACGCTGAGGCTTCATCAATTAAGTCTGGGAGCAACAAAAGC
CGAAGTCTGTTCGGAGGCAGCAGGCGGGGCAGTCTTTCATCAAAACGAGCACAGGCAGCCCCTGACGACGTTCCG
CCTTTGCCTGCGCCAATTCGTACTGATCTAACGGAGGAGAAGCCTCGTGCGCTTGAAGCGAGCCCCATGCCGAAC
ACCCCACCTCATACCGCTATTCCTGCACCAGAGACGACTGTAACCCCTCCAACACCAACTGAGCATCGCCCTCTC
AGTGCACAAATCCTATCTAACAATGTTACCGATTCGCCCGAGCCCCTACAAGAAAATTCTCCCGGTGTTACTATC
GTGAGCCCCTCTGGAAACATGATCTCTCACCGCCGGGTGCGGTCCGCTTCTGCAGCTCATGGCCCAAGCAAATTG
TCCAATTCAGTGTCTGCACTGACACCTCTTGAAGAAAAAACCCCGGGGGCGAAGAATGCAACTTCAAACCAGCAA
AGTGGCTTCTTCTCCTCCGTGTTTTCAGTTGCGCAAAACGCCGCCACTTCCTTAAGCAACAGCATCAACGCACAA
CAGAGAAATCGTCCAACATTTCAACCTGTTCCTGCTGATGCTGATAAATCACTCAATGAATCCACCTCGGAGGAG
GGCGAAAGGACATCGGATAACGGCAAGACTGAAGGGAGACCATCTGCTGTAGAGACTCTTGGGGCAGGAGATCTG
AACTTCAGCCATCTGGACATTGACGCACGACCCGGTGAGTCAATCACGACTGCCGACGGCGTGGTGATTACAAAG
CCAGTGAACCCCGCTGACAACCGCAAAAACACAGCTGTTTCCCGGCGAGATGAGGAAGCGGCTAAACTTGAAGAC
AAACGCGCAGCGCGCGCTGTTCAAGTAGCATACGAAAGACCCTCGGAGCTTTCATTGACGGGCCCTGCGGAAGAC
GCCCTGGAGATTGAGTCTAACACCTCACTTCCGAAAGATAGCTTAATTCTGGGTGATCAAACTCCTCCCAGTGGT
AGTATTATTGACGGTGACCTAAGCGGGGGCCTTGGGCGCTCAGGCAGTGTGCGCAGTAGGCTTGCCCGGCGTCAT
CGGGGCTCATCTGGGGCCACAGCCTCGACGATTGGAGCGATTGGCGCCAACCCCGCTGCCCTTGGTGTTCCTGGC
ATCAACTCCAGTGTGCCTCGGTTGACTGGCTTCGCTGTTGCGAGTAAGAAGCGCAATCGGGACTTTCACCAATTA
TTCCGGAGCGTACCTGAAGACGATTATCTTATCGAAGATTACAGCTGTGCGTTGCAACGTGAGATCATTCTTGCC
GGCCGCATTTATATTTCAGAAGGGCACATCTGTTTCTCTAGTAACATCCTGGGATGGGTCACGACTCTAGTGATC
AGCTTCGATGAGGTTGTTGCTATCGAAAAGGAAAACACGGCCATGGTGTTCCCCAATGCTATTGCCATTCAGACA
CTTCATGCGCGTCACACGTTCCGCAGTTTGCTCAGTCGCGAGTCCACCTATGACCTAATGGTTAATATTTGGAAG
ATCAACCATCCCACCATTAAGAGCTCTGTGAACGGAACCCGCGTAACCCATGGCACCGGTGATAAGACAGAGAAG
GTCGGGGAGGACGAGAGCGAGTCCGAGAGCGAGGCCACCGATGAAGATGAAATATACGACGAGGACGAGGAAGGA
GAGAATGCCGAGAGCTTCTACGAGGGTGGCGACAGCGCCAACAACAGTGCAACATCATTGCCATTGCAAAAAGGA
TTAAGTCGTAAGGCTTCGAATCTATCCACACATGCTGCCGTGCCAGTGGCCGGCACAAATGGCAATGGCGATAAA
AAGAACGGAGACAAGGGAACTTCCAAGGACGCGACTCCTGATTTCCCAGGTCCGACTACACATGCGCCTACCGAG
TACGTCGAAGCCAACGGACAGTACGAAAAAGTCATCAAAGATGAAATAATTCCTGCGCCGCTCGGCAAAGTCTTC
TCTTTGGTTTTTGGCCCAGCGTCGGGCGAATTTATGACCAAGTTCCTTGCCGACAATCAGAAATGTGGAGAGCTA
CAGTTCGAGGGAACACCGAAGGGTTTGACGATGGAAAGCCCAACCAGGAAGTACTCATACATCAAACCTCTCAAT
GGCTCTATCGGTCCGAGGCAGACCAAATGTATCAGCACCGAGACCATAGACTTATTGGACCTTGAAAAGGCCGTT
CTTGTCACCCTGAGCACCCAAACACCCGATGTGCCTAGTGGGAACGTATTTGCTACCATGACCAAGTACCTCTTC
ACATGGGCTCCTGGCAACCAAACTCGCTTCCTCATGACTTGTACTATTGAGTGGTCAGGCAAGAGTTGGCTTAAG
GGTCCTATTGAGAAAGGTGCAATTGATGGGCAAACGACCTTTGGTAATGAGCTGGTCAAAGCCTTGCAGGTTGGT
GTTGTTCCCCGTGGGCGTGGCGCTGGACGAGGCAAAGGAAAGCGCAAGAAGGGCGATGCCGCAGGGCGGGAGTCG
ACCGCAGCTGCTTCGTTGAAGGTTACTGTGGATTCCAACACCGGAAATGGGGAATCATGGGGACTATTCGAACCA
GTCCGCCCACTCCTAGAGCCCTTTACCAGCCTTCTCAGTCCGCTATGGACTAGCAACGTCGCTCTTCTAGTTATC
GCAATCTTGTTCTACATGGCGTTCTTCCGATCCTCGCCGTCGTCGTCCATGCTTTCGTCTGATGTCGGCTTTCCC
GGTCACAGCTTGCCTCAGAGACTGGCCGCATACGAGGAGATGTGGCGACGCGAAGAGACTGAGCTCTGGAATTGG
CTGGAAGACCGGGTTGGCATGGACGGAATGGTATTTCCAAACGTCTACCGGTCGCCCGAGCCACACCCAAGTCGT
AGGTCATCTGGAGCTAGTATACTCGATGAGCGCGAGCTCGCTGCACGGCTTCGCGAAGAGAAGATCACTGACCGT
GAGATGGACCATGCCATTCGCACTACCCGCCAACATCTCGACGTCCTTGAGAAGATGGTGGACAAACGCAAAGCC
CAATGGGAAGCCGATGAACCAGTGAAGTCCGAATTGTGA
Gene >Pro_DTO377G3_2|g3447.t1
ATGGCCGACTCTTCGTCTTCAAGCTTTAAAGGCGAGAACAGATCGCGCCGCTCCTGGACATTATCGGCAGAATCA
AGTGCAATCGGTAGCAACGGTCGGTCATCCCAGGAGTCGACCCTCGAGAGACCGAAAACCCAGGGTGGAGAAGCA
GCAGATCCTAAGGCTGGTCCTAGTGGATTCTCAAAGCTACTCGATGCGCGTCGGAGGCGGAAAGAGCATAAAAAA
AAGCAGCAGAAACAAGCCGACGAGCCGCCGGTGCCGACTGTTGTTTTGGAACAAGACCTGCATGAAAGCCGGTCC
AATGAATCTCGCGATGGGACCTCCGCAGCCCCGTCGTCGAGCACAGACAGCTGGGTGCCGGAGAATGAGGGCAAT
AATCTATTGACAGATGATTCCGAGCCGGACGGGTAAGTTGAACAACTGGCCTTCTCATTGTCTTGAACTACTCCT
AACCAGCTGATCTTTTTGGCTTCGTTTAGGCCCCCGCCGCTCACCTCACATGACTCCCATACCGGATTCTACACG
TCGTCCTCCCCAATGATCAAGACCAAATCGGTGGATACCGCAAATACGGAAGGATGGCATGGTGATGCCGAGTCA
GCTGTTAGCGGCTCTAGTGCCACCGGGTCAGAATCAAACCCGGGTGATAGAATCTCCCGACGCGCAACATCGGGT
ATGGCATTGGATGTCCCTACGGACTCAAATGGCAAGAAACGCAGTCCATCCCCTGGGCGACGCCTGAGAGGCGCG
TCCAATTCAGACAAAAAGGGTGCCAGTGACGACGCTGAGGCTTCATCAATTAAGTCTGGGAGCAACAAAAGCCGA
AGTCTGTTCGGAGGCAGCAGGCGGGGCAGTCTTTCATCAAAACGAGCACAGGCAGCCCCTGACGACGTTCCGCCT
TTGCCTGCGCCAATTCGTACTGATCTAACGGAGGAGAAGCCTCGTGCGCTTGAAGCGAGCCCCATGCCGAACACC
CCACCTCATACCGCTATTCCTGCACCAGAGACGACTGTAACCCCTCCAACACCAACTGAGCATCGCCCTCTCAGT
GCACAAATCCTATCTAACAATGTTACCGATTCGCCCGAGCCCCTACAAGAAAATTCTCCCGGTGTTACTATCGTG
AGCCCCTCTGGAAACATGATCTCTCACCGCCGGGTGCGGTCCGCTTCTGCAGCTCATGGCCCAAGCAAATTGTCC
AATTCAGTGTCTGCACTGACACCTCTTGAAGAAAAAACCCCGGGGGCGAAGAATGCAACTTCAAACCAGCAAAGT
GGCTTCTTCTCCTCCGTGTTTTCAGTTGCGCAAAACGCCGCCACTTCCTTAAGCAACAGCATCAACGCACAACAG
AGAAATCGTCCAACATTTCAACCTGTTCCTGCTGATGCTGATAAATCACTCAATGAATCCACCTCGGAGGAGGGC
GAAAGGACATCGGATAACGGCAAGACTGAAGGGAGACCATCTGCTGTAGAGACTCTTGGGGCAGGAGATCTGAAC
TTCAGCCATCTGGACATTGACGCACGACCCGGTGAGTCAATCACGACTGCCGACGGCGTGGTGATTACAAAGCCA
GTGAACCCCGCTGACAACCGCAAAAACACAGCTGTTTCCCGGCGAGATGAGGAAGCGGCTAAACTTGAAGACAAA
CGCGCAGCGCGCGCTGTTCAAGTAGCATACGAAAGACCCTCGGAGCTTTCATTGACGGGCCCTGCGGAAGACGCC
CTGGAGATTGAGTCTAACACCTCACTTCCGAAAGATAGCTTAATTCTGGGTGATCAAACTCCTCCCAGTGGTAGT
ATTATTGACGGTGACCTAAGCGGGGGCCTTGGGCGCTCAGGCAGTGTGCGCAGTAGGCTTGCCCGGCGTCATCGG
GGCTCATCTGGGGCCACAGCCTCGACGATTGGAGCGATTGGCGCCAACCCCGCTGCCCTTGGTGTTCCTGGCATC
AACTCCAGTGTGCCTCGGTTGACTGGCTTCGCTGTTGCGAGTAAGAAGCGCAATCGGGACTTTCACCAATTATTC
CGGAGCGTACCTGAAGACGATTATCTTATCGAAGATTACAGCTGTGCGTTGCAACGTGAGATCATTCTTGCCGGC
CGCATTTATATTTCAGAAGGGCACATCTGTTTCTCTAGTAACATCCTGGGATGGGTCACGACTCTAGTGATCAGC
TTCGATGAGGTTGTTGCTATCGAAAAGGAAAACACGGCCATGGTGTTCCCCAATGCTATTGCCATTCAGACACTT
CATGCGCGTCACACGTTCCGCAGTTTGCTCAGTCGCGAGTCCACCTATGACCTAATGGTTAATATTTGGAAGATC
AACCATCCCACCATTAAGAGCTCTGTGAACGGAACCCGCGTAACCCATGGCACCGGTGATAAGACAGAGAAGGTC
GGGGAGGACGAGAGCGAGTCCGAGAGCGAGGCCACCGATGAAGATGAAATATACGACGAGGACGAGGAAGGAGAG
AATGCCGAGAGCTTCTACGAGGGTGGCGACAGCGCCAACAACAGTGCAACATCATTGCCATTGCAAAAAGGATTA
AGTCGTAAGGCTTCGAATCTATCCACACATGCTGCCGTGCCAGTGGCCGGCACAAATGGCAATGGCGATAAAAAG
AACGGAGACAAGGGAACTTCCAAGGACGCGACTCCTGATTTCCCAGGTCCGACTACACATGCGCCTACCGAGTAC
GTCGAAGCCAACGGACAGTACGAAAAAGTCATCAAAGATGAAATAATTCCTGCGCCGCTCGGCAAAGTCTTCTCT
TTGGTTTTTGGCCCAGCGTCGGGCGAATTTATGACCAAGTTCCTTGCCGACAATCAGAAATGTGGAGAGCTACAG
TTCGAGGGAACACCGAAGGGTTTGACGATGGAAAGCCCAACCAGGAAGTACTCATACATCAAACCTCTCAATGGC
TCTATCGGTCCGAGGCAGACCAAATGTATCAGCACCGAGACCATAGACTTATTGGACCTTGAAAAGGCCGTTCTT
GTCACCCTGAGCACCCAAACACCCGATGTGCCTAGTGGGAACGTATTTGCTACCATGACCAAGTACCTCTTCACA
TGGGCTCCTGGCAACCAAACTCGCTTCCTCATGACTTGTACTATTGAGTGGTCAGGCAAGAGTTGGCTTAAGGGT
CCTATTGAGAAAGGTGCAATTGATGGGCAAACGACCTTTGGTAATGAGCTGGTCAAAGCCTTGCAGGTTGGTGTT
GTTCCCCGTGGGCGTGGCGCTGGACGAGGCAAAGGAAAGCGCAAGAAGGGCGATGCCGCAGGGCGGGAGTCGACC
GCAGCTGCTTCGTTGAAGGTTACTGTGGATTCCAACACCGGAAATGGGGAATCATGGGGACTATTCGAACCAGTC
CGCCCACTCCTAGAGCCCTTTACCAGCCTTCTCAGTCCGCTATGGACTAGCAACGTCGCTCTTCTAGTTATCGCA
ATCTTGTTCTACATGGCGTTCTTCCGATCCTCGCCGTCGTCGTCCATGCTTTCGTCTGATGTCGGCTTTCCCGGT
CACAGCTTGCCTCAGAGACTGGCCGCATACGAGGAGATGTGGCGACGCGAAGAGACTGAGCTCTGGAATTGGCTG
GAAGACCGGGTTGGCATGGACGGAATGGTATTTCCAAACGTCTACCGGTCGCCCGAGCCACACCCAAGTCGTAGG
TCATCTGGAGCTAGTATACTCGATGAGCGCGAGCTCGCTGCACGGCTTCGCGAAGAGAAGATCACTGACCGTGAG
ATGGACCATGCCATTCGCACTACCCGCCAACATCTCGACGTCCTTGAGAAGATGGTGGACAAACGCAAAGCCCAA
TGGGAAGCCGATGAACCAGTGAAGTCCGAATTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail