Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3441.t1
Gene name
Locationscaffold_05:698071..699694
Strand-
Gene length (bp)1623
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 5.9E-65 46 508
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-12 48 449

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 100 119 19
2 129 151 22
3 306 328 22
4 343 365 22
5 372 394 22
6 404 426 22
7 446 465 19
8 475 494 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 46.50 26.39 66.62
5d_25C Five days - 25 degrees Celsius 37.08 21.29 52.88
7d_25C Seven days - 25 degrees Celsius 32.86 17.80 47.93
10d_25C Ten days - 25 degrees Celsius 10.02 4.29 15.76
7d_15C Seven days - 15 degrees Celsius 28.06 13.26 42.86
7d_30C Seven days - 30 degrees Celsius 15.35 7.20 23.50

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.413424 no
3d_25C 7d_25C 0.179558 no
3d_25C 7d_15C 0.057587 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.714371 no
5d_25C 7d_15C 0.347983 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.653765 no
7d_25C 7d_30C 0.002761 yes
7d_25C 10d_25C 0.000700 yes
7d_15C 7d_30C 0.030863 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.177767 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3441.t1
MDLRHEIPKIEPGLSSNDTLTDSITRNITTKNAPSTTGSMLRLSLWVSFAAWISNFDNGYAGTVLIMPSYKHAFG
SCVQVIDPNTYAEIRHCSLTPLQQSLISLNFLFVAIGGAIAGMTGRYFGRRGSIQAGCTLAIIGAAGMLGTSGSF
LRYMVCRSISAVGVGQLIVSSVTYGSECIVANKRGLSLGLYNVGLAGGNLAASAVCAGSARLEATNDWQWKTPIL
CQIPLGVILGAGILMLPESPRWLMIHGREEEARSSFGVLYCQSPYSPEITMQIDDIRTNLAIERASLKSVSCFDI
YRRKHISRTLISAMIMIGIAITGIQFVQPYAALFLKGVGISDPYLINVIIGLCILGGSFFGPFIVEYGGRRIAML
SGYIVMAVCMLTLSSVSTALGMDTSAEIVIVVLLCLWAFVFGGTIAASANLSSVEMHSVSLRTYGQANTTVFYGI
FAFGATFWTPYMLGAGYGDMGPNVGYFYAGVTVVIAILTFLLVPETAGITLEQIDEGFDSGIKAWKTSLPKNRAI
ASSQKRSMAGGHVGA*
Coding >Pro_DTO377G3_2|g3441.t1
ATGGATTTGCGACACGAAATTCCGAAAATAGAGCCTGGGTTGAGCTCTAATGACACACTCACCGATTCCATTACC
CGAAACATTACCACAAAAAATGCTCCAAGCACGACCGGATCGATGCTGCGTCTTTCATTATGGGTCTCGTTTGCC
GCATGGATCTCGAACTTCGACAACGGCTACGCCGGTACGGTGCTGATCATGCCGTCCTACAAACACGCCTTTGGA
AGCTGCGTGCAAGTTATAGACCCGAATACGTATGCCGAAATTCGACATTGCTCATTGACGCCACTACAACAATCT
CTTATCAGCCTCAACTTCTTGTTCGTTGCCATTGGAGGTGCGATTGCGGGCATGACCGGCCGATACTTCGGGCGC
AGGGGGTCAATCCAAGCTGGATGTACATTGGCTATTATCGGTGCTGCTGGAATGCTTGGCACCAGCGGTAGCTTC
TTGCGCTACATGGTGTGCAGATCGATCAGTGCTGTGGGAGTTGGACAGTTGATTGTATCCAGCGTCACTTATGGT
TCTGAGTGCATTGTCGCCAACAAGCGCGGCCTGTCCTTAGGGTTGTATAATGTTGGACTTGCCGGAGGAAATCTT
GCTGCTTCCGCGGTGTGTGCAGGTTCTGCTCGTCTAGAGGCAACCAATGACTGGCAGTGGAAGACACCCATTTTA
TGCCAAATACCCTTGGGGGTTATTCTCGGTGCTGGGATTTTGATGCTTCCCGAGTCGCCGCGCTGGCTTATGATA
CACGGTCGAGAGGAGGAGGCACGCAGCTCATTCGGCGTGCTATACTGCCAAAGTCCATATTCGCCGGAAATCACC
ATGCAGATTGATGATATAAGAACCAACCTTGCAATCGAGCGTGCAAGCCTCAAATCTGTCTCATGCTTTGATATC
TATCGCAGGAAGCATATCAGCCGTACCTTGATATCTGCTATGATCATGATTGGAATCGCCATTACTGGTATCCAA
TTTGTACAACCATACGCTGCACTGTTCCTCAAAGGAGTTGGCATCAGTGACCCATATTTGATCAATGTTATCATC
GGCTTGTGCATCCTAGGAGGATCATTTTTTGGTCCGTTCATTGTGGAATATGGCGGAAGAAGAATTGCCATGCTT
TCCGGCTATATTGTCATGGCTGTCTGCATGCTCACTCTTTCCTCTGTGAGCACCGCTCTTGGAATGGATACAAGT
GCAGAGATAGTTATCGTCGTTCTTCTGTGTTTGTGGGCTTTTGTCTTTGGTGGGACTATTGCTGCGAGTGCTAAC
CTATCTTCTGTGGAGATGCACAGCGTCTCACTCCGCACTTACGGACAAGCCAACACAACAGTGTTCTATGGTATC
TTTGCCTTTGGTGCAACATTTTGGACGCCTTACATGTTAGGTGCGGGTTATGGGGACATGGGTCCCAACGTGGGC
TATTTTTATGCAGGTGTCACCGTCGTCATCGCTATTTTAACCTTCTTGCTCGTGCCAGAGACTGCTGGAATTACA
CTGGAACAGATTGACGAAGGTTTTGACTCGGGAATAAAGGCATGGAAAACGTCACTACCCAAGAATAGAGCTATT
GCTTCCTCTCAGAAACGAAGTATGGCAGGTGGACACGTTGGAGCTTGA
Transcript >Pro_DTO377G3_2|g3441.t1
ATGGATTTGCGACACGAAATTCCGAAAATAGAGCCTGGGTTGAGCTCTAATGACACACTCACCGATTCCATTACC
CGAAACATTACCACAAAAAATGCTCCAAGCACGACCGGATCGATGCTGCGTCTTTCATTATGGGTCTCGTTTGCC
GCATGGATCTCGAACTTCGACAACGGCTACGCCGGTACGGTGCTGATCATGCCGTCCTACAAACACGCCTTTGGA
AGCTGCGTGCAAGTTATAGACCCGAATACGTATGCCGAAATTCGACATTGCTCATTGACGCCACTACAACAATCT
CTTATCAGCCTCAACTTCTTGTTCGTTGCCATTGGAGGTGCGATTGCGGGCATGACCGGCCGATACTTCGGGCGC
AGGGGGTCAATCCAAGCTGGATGTACATTGGCTATTATCGGTGCTGCTGGAATGCTTGGCACCAGCGGTAGCTTC
TTGCGCTACATGGTGTGCAGATCGATCAGTGCTGTGGGAGTTGGACAGTTGATTGTATCCAGCGTCACTTATGGT
TCTGAGTGCATTGTCGCCAACAAGCGCGGCCTGTCCTTAGGGTTGTATAATGTTGGACTTGCCGGAGGAAATCTT
GCTGCTTCCGCGGTGTGTGCAGGTTCTGCTCGTCTAGAGGCAACCAATGACTGGCAGTGGAAGACACCCATTTTA
TGCCAAATACCCTTGGGGGTTATTCTCGGTGCTGGGATTTTGATGCTTCCCGAGTCGCCGCGCTGGCTTATGATA
CACGGTCGAGAGGAGGAGGCACGCAGCTCATTCGGCGTGCTATACTGCCAAAGTCCATATTCGCCGGAAATCACC
ATGCAGATTGATGATATAAGAACCAACCTTGCAATCGAGCGTGCAAGCCTCAAATCTGTCTCATGCTTTGATATC
TATCGCAGGAAGCATATCAGCCGTACCTTGATATCTGCTATGATCATGATTGGAATCGCCATTACTGGTATCCAA
TTTGTACAACCATACGCTGCACTGTTCCTCAAAGGAGTTGGCATCAGTGACCCATATTTGATCAATGTTATCATC
GGCTTGTGCATCCTAGGAGGATCATTTTTTGGTCCGTTCATTGTGGAATATGGCGGAAGAAGAATTGCCATGCTT
TCCGGCTATATTGTCATGGCTGTCTGCATGCTCACTCTTTCCTCTGTGAGCACCGCTCTTGGAATGGATACAAGT
GCAGAGATAGTTATCGTCGTTCTTCTGTGTTTGTGGGCTTTTGTCTTTGGTGGGACTATTGCTGCGAGTGCTAAC
CTATCTTCTGTGGAGATGCACAGCGTCTCACTCCGCACTTACGGACAAGCCAACACAACAGTGTTCTATGGTATC
TTTGCCTTTGGTGCAACATTTTGGACGCCTTACATGTTAGGTGCGGGTTATGGGGACATGGGTCCCAACGTGGGC
TATTTTTATGCAGGTGTCACCGTCGTCATCGCTATTTTAACCTTCTTGCTCGTGCCAGAGACTGCTGGAATTACA
CTGGAACAGATTGACGAAGGTTTTGACTCGGGAATAAAGGCATGGAAAACGTCACTACCCAAGAATAGAGCTATT
GCTTCCTCTCAGAAACGAAGTATGGCAGGTGGACACGTTGGAGCTTGA
Gene >Pro_DTO377G3_2|g3441.t1
ATGGATTTGCGACACGAAATTCCGAAAATAGAGCCTGGGTTGAGCTCTAATGACACACTCACCGATTCCATTACC
CGAAACATTACCACAAAAAATGCTCCAAGCACGACCGGATCGATGCTGCGTCTTTCATTATGGGTCTCGTTTGCC
GCATGGATCTCGAACTTCGACAACGGCTACGCCGGTACGGTGCTGATCATGCCGTCCTACAAACACGCCTTTGGA
AGCTGCGTGCAAGTTATAGACCCGAATACGTATGCCGAAATTCGACATTGCTCATTGACGCCACTACAACAATCT
CTTATCAGCCTCAACTTCTTGTTCGTTGCCATTGGAGGTGCGATTGCGGGCATGACCGGCCGATACTTCGGGCGC
AGGGGGTCAATCCAAGCTGGATGTACATTGGCTATTATCGGTGCTGCTGGAATGCTTGGCACCAGCGGTAGCTTC
TTGCGCTACATGGTGTGCAGATCGATCAGTGCTGTGGGAGTTGGACAGTTGATTGTATCCAGCGTCACTTATGGT
TCTGAGTGCATTGTCGCCAACAAGCGCGGCCTGTCCTTAGGGTTGTATAATGTTGGACTTGCCGGAGGAAATCTT
GCTGCTTCCGCGGTGTGTGCAGGTTCTGCTCGTCTAGAGGCAACCAATGACTGGCAGTGGAAGACACCCATTTTA
TGCCAAATACCCTTGGGGGTTATTCTCGGTGCTGGGATTTTGATGCTTCCCGAGTCGCCGCGCTGGCTTATGATA
CACGGTCGAGAGGAGGAGGCACGCAGCTCATTCGGCGTGCTATACTGCCAAAGTCCATATTCGCCGGAAATCACC
ATGCAGATTGATGATATAAGAACCAACCTTGCAATCGAGCGTGCAAGCCTCAAATCTGTCTCATGCTTTGATATC
TATCGCAGGAAGCATATCAGCCGTACCTTGATATCTGCTATGATCATGATTGGAATCGCCATTACTGGTATCCAA
TTTGTACAACCATACGCTGCACTGTTCCTCAAAGGAGTTGGCATCAGTGACCCATATTTGATCAATGTTATCATC
GGCTTGTGCATCCTAGGAGGATCATTTTTTGGTCCGTTCATTGTGGAATATGGCGGAAGAAGAATTGCCATGCTT
TCCGGCTATATTGTCATGGCTGTCTGCATGCTCACTCTTTCCTCTGTGAGCACCGCTCTTGGAATGGATACAAGT
GCAGAGATAGTTATCGTCGTTCTTCTGTGTTTGTGGGCTTTTGTCTTTGGTGGGACTATTGCTGCGAGTGCTAAC
CTATCTTCTGTGGAGATGCACAGCGTCTCACTCCGCACTTACGGACAAGCCAACACAACAGTGTTCTATGGTATC
TTTGCCTTTGGTGCAACATTTTGGACGCCTTACATGTTAGGTGCGGGTTATGGGGACATGGGTCCCAACGTGGGC
TATTTTTATGCAGGTGTCACCGTCGTCATCGCTATTTTAACCTTCTTGCTCGTGCCAGAGACTGCTGGAATTACA
CTGGAACAGATTGACGAAGGTTTTGACTCGGGAATAAAGGCATGGAAAACGTCACTACCCAAGAATAGAGCTATT
GCTTCCTCTCAGAAACGAAGTATGGCAGGTGGACACGTTGGAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail