Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3439.t1
Gene name
Locationscaffold_05:688582..693938
Strand-
Gene length (bp)5356
Transcript length (bp)5298
Coding sequence length (bp)5298
Protein length (aa) 1766

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00780 CNH CNH domain 1.8E-62 1407 1696
PF00621 RhoGEF RhoGEF domain 9.0E-35 949 1133
PF15405 PH_5 Pleckstrin homology domain 2.3E-11 1174 1320

GO

GO Term Description Terminal node
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0030234 enzyme regulator activity No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0030695 GTPase regulator activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3439.t1
MSQYPNGQQAYYGQSTNPQAPTQPSTGHYDNYTPAPDRHLPRRMPSYNAGDDSGFFNPVQTQNMRATEENSQYAA
QGGGYGGSAGQGGYNDVQRATEDDRDSRYSRTSSDAMSRMSPSRASSQTSTMSYQYQYSGAPSSQTAYNPQQYGL
PHTQSQPVLAYNPQTYTGSSNASYAGPALGHQPYNPAAYQSTAMSGMSSPVLPRRQSAASHYGQTPPTPQSYGFS
QQSPLPPPRGADHPYGGRPYQPMSPVTSPSYVPSSSPGIMHMPPPTSRSYYSNPQGASYDLPSPRYTPAIPSGSF
EEQPPAPPVHQTQANGLYGKRPSVAGRTLPTPPVQLDLPQHPRRTETLTRHPQSRPLPGPPVDEAGLDGNRWPAE
PPMAYENVLREDEDSQNFSRHGSRASHASSHSRMQFLPDEEQTHTNGNIETDTGHMINDDAYSEESDPEAAAGLI
MLQEDIAREEREKGRMRRETNASVLSSRGSNISPREPSPHSDSLGDNEFIGHDLSQDEGGYQANVHYGIYSSEEY
SDPAAGDRFPGTSGSFRSSGSPDERGEYYNDYEHPPIAYDYARRLHHLPADARVDASGTGGLSAPDAYSRRMSFD
YGDEGESPYDHTHSGDQSDDESAHRSAHEDLFFHPGMRPLPPAPVEPAGNVDLVSHLMPAGTYNRHSEQQDDLDS
YSQYNNPALLNSADSYGEALLNQSQVPRSSSLSAPIGPRTDAPIRSKTDADRLRYRQQQQELLLQLQHKDLPHID
PAAAAMTLDLPSIPAGRRKRFHPAKLSSEQFKKCTEPWALSSLLSWIKDLSEDETDLREQAIADAMVALFTHKVP
TMNIADAETLAARVVSGMLEEGALVKEEEWVKFGSGTLSGILFQITGTGCYSPRLHLHEMHIEGTDSFGRCYSHH
CMRTLKKVNLKAQMMAPQKKIEDWVTFYKVPKEVWEAHPRKEVDRQNNLHEIVTTEDSYISQLDVLRELYRDQLA
KMNPPIIPVKRLPKFLADVFGKVDAVKRVNEDFLLAQLKYRQKEQGPFISGFSDIFREWIRKAKNVYIDYAATFP
TANYLVRKEAERNPHFKQFLNQAREHKLSSRLSWDTFLKAPITRIQRYTLLLATVHKNMVKDSEEKGNLAQAIEE
IKVVALECDNKVGEMNKKADLMELASKLQLRPDMKKEVELNLEHLGRQIVYRGELQRPGTRTRFLVDTHAILFDH
YLVLAKVFTMRDRAVKYERYDISKLPIPMDLLGLESTDDDPVVKSSVRGVSTVTPSQAGAASPLAHTGSGASGGN
GALDNSRDDKILYPFRIKHLGKTGTYTLYAFSAQSRLEWCQKIIEAKTKHAAALFSQNAEPFRLRVLADTAFAYS
DHTPGSKSVTIKGTPLHRAIVEVEKQYESSKARPPAICKTAVNCATVFQQPPGRIMCAIGTDYGVYMSELNNPRG
WYRAIPITRVTQVAVFEDFNLLLLIADRSLIAYHLDVVCPANGKTSQSSQDSARRAPQKLSGNREVGFFAAGRLK
DRYLVLYKKREGLSSTFKVLEPVLQKSSTNKGRLFSRRSQTEFFRDYDEFYIPAETYRINMFHSSLAISTQKGIE
VLTLDKKLSWSVPDFSSNDTGDAHDTLHSIANRISGLKPLGMFRLSESEFLVAYQQCAVYVNKHGDVSRSVVMEF
VGSAHTACLYGKFLILFNDDFVEVRNAMNGRLRQVIPGHNVVCIDDGSKVPGSLNGNAQANIGGSMGLSSGFSGA
ANGSPGPTGMGNTVKICMQHPEYERSQLALELVENEGQKD*
Coding >Pro_DTO377G3_2|g3439.t1
ATGTCGCAATATCCAAACGGTCAACAGGCATACTATGGCCAATCTACAAACCCCCAAGCCCCTACTCAACCATCC
ACCGGCCACTATGACAATTATACCCCCGCGCCGGACAGACATCTGCCTCGAAGGATGCCGAGTTACAATGCCGGG
GATGATTCTGGATTCTTCAACCCTGTCCAGACCCAGAATATGAGAGCGACCGAAGAAAACAGCCAGTATGCAGCA
CAAGGCGGTGGTTATGGTGGCAGCGCGGGACAGGGTGGCTACAATGATGTGCAGAGAGCCACTGAAGACGACAGA
GACTCGAGATATTCGCGGACTTCCTCAGACGCCATGTCGCGTATGTCTCCGAGTCGGGCCTCTTCGCAAACCTCC
ACTATGTCTTATCAATACCAATACTCTGGAGCACCCTCGTCCCAGACGGCCTACAACCCGCAGCAATACGGCCTT
CCACACACGCAGTCGCAACCGGTTCTCGCTTATAACCCCCAGACGTACACTGGCTCCAGCAATGCTTCATACGCC
GGTCCCGCCTTGGGCCATCAACCATATAATCCTGCGGCATACCAGTCTACCGCAATGTCGGGAATGAGCTCTCCG
GTTCTACCTAGAAGGCAGAGCGCAGCTTCACACTACGGGCAGACACCGCCGACTCCACAATCGTATGGCTTTTCC
CAACAATCACCGCTTCCACCGCCAAGGGGCGCCGATCATCCGTATGGAGGACGTCCGTACCAACCCATGTCACCG
GTCACCTCGCCTTCCTATGTTCCCTCAAGCTCCCCGGGCATAATGCATATGCCTCCGCCTACATCACGTTCTTAT
TACAGCAACCCACAAGGGGCGTCGTATGATCTGCCATCTCCTCGGTATACCCCAGCGATCCCAAGCGGTTCCTTC
GAAGAGCAGCCTCCGGCGCCTCCAGTTCATCAGACTCAAGCAAATGGCTTGTACGGCAAGCGGCCAAGTGTAGCA
GGGCGAACCCTGCCGACGCCCCCTGTGCAGCTAGACTTGCCTCAACATCCGAGGCGAACTGAGACGTTGACTCGA
CACCCCCAGTCCCGGCCTCTTCCTGGACCCCCAGTCGATGAAGCTGGGCTAGATGGCAATCGTTGGCCAGCGGAA
CCTCCTATGGCATATGAAAATGTGCTCAGAGAAGATGAGGACTCTCAGAACTTTTCCCGTCACGGCTCTAGAGCA
TCCCATGCTAGCTCCCATTCACGCATGCAGTTCTTGCCGGATGAGGAACAAACCCACACCAACGGTAATATAGAG
ACAGACACTGGTCATATGATAAATGACGATGCCTACAGTGAGGAAAGCGACCCAGAGGCTGCTGCTGGTTTGATT
ATGTTGCAAGAAGACATAGCGCGTGAGGAACGTGAGAAAGGGCGGATGCGACGTGAGACCAATGCGTCAGTTCTC
AGCTCACGTGGATCCAACATATCGCCAAGAGAGCCTTCACCGCACTCTGATTCACTTGGAGATAACGAGTTCATC
GGCCATGACCTTTCGCAGGACGAAGGGGGCTACCAAGCAAACGTGCACTACGGTATTTACAGTTCGGAAGAGTAT
TCGGACCCTGCCGCGGGCGACAGATTCCCAGGCACCTCTGGTTCATTCAGAAGCTCCGGGTCCCCCGATGAGCGT
GGGGAGTATTATAATGATTACGAGCACCCGCCTATTGCATATGATTATGCCAGGCGCCTCCATCATTTGCCGGCC
GATGCCAGGGTAGATGCCAGTGGTACTGGGGGATTATCGGCACCGGATGCCTATTCCCGACGGATGAGCTTTGAC
TATGGCGATGAAGGAGAATCACCATATGATCACACCCATTCTGGAGATCAATCCGATGACGAAAGCGCCCACCGA
TCCGCACACGAAGATCTGTTCTTCCACCCTGGAATGCGTCCATTGCCACCAGCACCTGTAGAGCCTGCTGGTAAT
GTTGATCTTGTGTCACATCTGATGCCTGCGGGCACATATAACCGCCACTCGGAGCAGCAAGATGACTTGGACAGC
TATTCACAGTATAACAACCCCGCCTTACTGAACTCTGCGGATTCTTATGGCGAGGCTTTGCTAAACCAGTCCCAA
GTTCCGCGGTCGTCATCTTTGTCAGCTCCCATTGGGCCTCGTACTGATGCACCCATCAGATCGAAGACCGACGCG
GACCGGCTCAGATACAGGCAGCAGCAGCAAGAACTTCTCTTGCAGCTTCAGCACAAGGACCTGCCTCATATCGAC
CCAGCGGCAGCAGCTATGACGCTGGATCTGCCAAGCATCCCGGCTGGCCGGCGCAAGAGATTCCATCCTGCAAAG
CTGTCATCGGAACAATTCAAGAAGTGTACCGAGCCGTGGGCTTTGAGCTCTCTCTTGTCCTGGATTAAAGATCTG
AGTGAGGATGAAACAGATCTCAGAGAGCAAGCAATTGCCGATGCCATGGTTGCGTTATTCACTCACAAAGTCCCC
ACCATGAATATTGCTGATGCCGAGACACTGGCTGCTCGAGTTGTGAGTGGCATGCTTGAAGAAGGTGCATTGGTA
AAAGAAGAAGAATGGGTCAAGTTTGGCTCAGGCACTCTTTCGGGTATCCTGTTCCAGATCACTGGCACTGGATGT
TACTCTCCCCGGCTCCACTTACATGAGATGCACATTGAGGGTACTGATAGCTTCGGTCGATGCTACTCTCATCAC
TGTATGCGAACATTGAAGAAGGTCAACCTCAAGGCACAGATGATGGCACCGCAGAAGAAAATCGAGGACTGGGTC
ACTTTCTACAAGGTCCCCAAGGAGGTCTGGGAAGCTCATCCGAGGAAAGAGGTCGATCGACAGAACAATCTGCAC
GAAATTGTCACTACAGAAGACTCCTACATCTCACAACTGGATGTCCTACGAGAACTATATCGTGATCAATTGGCT
AAGATGAATCCTCCCATCATTCCGGTGAAGCGATTACCCAAATTCTTGGCCGACGTGTTTGGCAAGGTTGATGCT
GTGAAGAGAGTCAACGAGGATTTCCTGTTGGCCCAGCTTAAATACCGCCAAAAAGAACAAGGGCCTTTTATCTCT
GGATTCAGTGACATCTTCCGGGAATGGATTCGCAAAGCTAAGAATGTTTACATCGACTACGCTGCAACCTTCCCA
ACGGCCAACTATCTTGTACGCAAGGAGGCTGAACGCAACCCGCACTTCAAGCAATTCCTAAACCAAGCCCGGGAA
CACAAGCTATCAAGTCGCCTTAGCTGGGATACTTTCCTCAAAGCCCCGATCACCAGAATCCAGCGGTATACTCTT
CTGTTGGCGACTGTCCACAAAAATATGGTCAAGGATTCCGAAGAAAAAGGAAATTTGGCACAGGCCATTGAAGAA
ATCAAGGTCGTTGCGCTGGAGTGTGACAACAAAGTGGGAGAGATGAACAAGAAGGCCGACTTGATGGAGTTGGCG
TCCAAGCTGCAATTGCGGCCCGACATGAAGAAGGAAGTTGAACTCAACCTTGAACACTTGGGTCGGCAGATCGTC
TATCGAGGCGAACTGCAACGTCCTGGAACCCGTACAAGATTCCTTGTTGATACACATGCCATCCTGTTCGACCAT
TATCTCGTTCTTGCTAAGGTATTCACGATGCGCGACCGGGCAGTGAAGTACGAGCGATACGATATCTCGAAATTG
CCTATCCCAATGGATCTATTGGGCCTTGAAAGCACCGACGATGATCCCGTGGTCAAATCATCGGTCCGGGGAGTT
TCGACTGTCACACCTTCCCAAGCAGGTGCTGCCAGCCCTCTTGCACATACAGGGTCTGGTGCTTCTGGAGGAAAC
GGTGCTCTTGACAACTCAAGGGATGACAAGATTCTATATCCTTTCAGAATCAAGCATCTAGGCAAAACTGGAACA
TATACTCTCTACGCCTTTTCAGCGCAAAGCCGCCTGGAATGGTGCCAAAAGATCATCGAAGCGAAGACAAAGCAT
GCTGCTGCTCTCTTCTCGCAAAATGCCGAGCCATTCCGACTGCGCGTGCTTGCGGACACTGCGTTCGCATACTCT
GATCATACACCCGGCTCTAAAAGTGTCACCATCAAGGGCACCCCTCTCCATCGTGCGATTGTGGAGGTCGAGAAA
CAATATGAAAGCTCTAAAGCTCGCCCTCCTGCGATATGCAAGACTGCAGTCAACTGTGCCACGGTGTTCCAACAG
CCACCTGGGCGGATTATGTGTGCAATTGGCACGGACTATGGAGTTTACATGTCCGAGCTCAATAACCCCAGGGGT
TGGTACAGGGCTATTCCCATCACACGGGTCACACAAGTTGCTGTCTTTGAGGATTTCAATTTGCTGTTGTTGATT
GCCGATCGGTCTTTGATTGCATACCACCTCGACGTGGTCTGTCCCGCCAATGGGAAAACCTCCCAATCATCTCAG
GATTCTGCCCGACGAGCACCGCAGAAGCTGTCTGGAAATCGTGAAGTGGGCTTCTTTGCCGCTGGTCGCCTGAAG
GACCGCTACTTGGTCTTATACAAGAAGCGTGAGGGTTTGTCGTCTACGTTCAAGGTTCTCGAGCCCGTCCTGCAA
AAATCATCCACAAATAAGGGCCGCCTGTTCTCACGTCGCTCGCAAACGGAGTTCTTCCGCGATTACGACGAGTTC
TACATCCCTGCCGAGACCTACCGAATTAACATGTTCCACTCCTCGCTTGCCATCTCAACCCAAAAGGGCATTGAA
GTCCTCACCCTTGACAAGAAACTTTCATGGTCTGTCCCAGATTTTAGCTCCAACGATACTGGAGATGCACACGAT
ACCCTCCACAGCATTGCCAATCGCATCAGCGGGCTCAAGCCGCTAGGCATGTTCCGTCTCAGCGAGAGCGAGTTC
CTAGTAGCTTACCAGCAGTGTGCTGTGTACGTCAACAAGCACGGCGACGTCTCTCGCAGTGTAGTCATGGAGTTC
GTGGGCAGCGCACACACAGCCTGTCTCTATGGCAAATTCCTAATTCTCTTCAACGACGACTTCGTCGAAGTCCGC
AACGCAATGAACGGTCGCTTACGCCAGGTTATTCCGGGCCACAACGTCGTCTGCATTGACGACGGTAGCAAGGTG
CCTGGCTCGCTCAACGGCAATGCACAAGCCAACATCGGTGGCTCGATGGGTCTTTCAAGCGGCTTCTCTGGCGCG
GCCAATGGCTCCCCGGGCCCCACGGGCATGGGCAACACGGTCAAAATCTGCATGCAGCATCCAGAGTATGAGCGA
AGCCAGCTTGCCTTGGAACTTGTCGAAAATGAGGGGCAAAAAGACTAA
Transcript >Pro_DTO377G3_2|g3439.t1
ATGTCGCAATATCCAAACGGTCAACAGGCATACTATGGCCAATCTACAAACCCCCAAGCCCCTACTCAACCATCC
ACCGGCCACTATGACAATTATACCCCCGCGCCGGACAGACATCTGCCTCGAAGGATGCCGAGTTACAATGCCGGG
GATGATTCTGGATTCTTCAACCCTGTCCAGACCCAGAATATGAGAGCGACCGAAGAAAACAGCCAGTATGCAGCA
CAAGGCGGTGGTTATGGTGGCAGCGCGGGACAGGGTGGCTACAATGATGTGCAGAGAGCCACTGAAGACGACAGA
GACTCGAGATATTCGCGGACTTCCTCAGACGCCATGTCGCGTATGTCTCCGAGTCGGGCCTCTTCGCAAACCTCC
ACTATGTCTTATCAATACCAATACTCTGGAGCACCCTCGTCCCAGACGGCCTACAACCCGCAGCAATACGGCCTT
CCACACACGCAGTCGCAACCGGTTCTCGCTTATAACCCCCAGACGTACACTGGCTCCAGCAATGCTTCATACGCC
GGTCCCGCCTTGGGCCATCAACCATATAATCCTGCGGCATACCAGTCTACCGCAATGTCGGGAATGAGCTCTCCG
GTTCTACCTAGAAGGCAGAGCGCAGCTTCACACTACGGGCAGACACCGCCGACTCCACAATCGTATGGCTTTTCC
CAACAATCACCGCTTCCACCGCCAAGGGGCGCCGATCATCCGTATGGAGGACGTCCGTACCAACCCATGTCACCG
GTCACCTCGCCTTCCTATGTTCCCTCAAGCTCCCCGGGCATAATGCATATGCCTCCGCCTACATCACGTTCTTAT
TACAGCAACCCACAAGGGGCGTCGTATGATCTGCCATCTCCTCGGTATACCCCAGCGATCCCAAGCGGTTCCTTC
GAAGAGCAGCCTCCGGCGCCTCCAGTTCATCAGACTCAAGCAAATGGCTTGTACGGCAAGCGGCCAAGTGTAGCA
GGGCGAACCCTGCCGACGCCCCCTGTGCAGCTAGACTTGCCTCAACATCCGAGGCGAACTGAGACGTTGACTCGA
CACCCCCAGTCCCGGCCTCTTCCTGGACCCCCAGTCGATGAAGCTGGGCTAGATGGCAATCGTTGGCCAGCGGAA
CCTCCTATGGCATATGAAAATGTGCTCAGAGAAGATGAGGACTCTCAGAACTTTTCCCGTCACGGCTCTAGAGCA
TCCCATGCTAGCTCCCATTCACGCATGCAGTTCTTGCCGGATGAGGAACAAACCCACACCAACGGTAATATAGAG
ACAGACACTGGTCATATGATAAATGACGATGCCTACAGTGAGGAAAGCGACCCAGAGGCTGCTGCTGGTTTGATT
ATGTTGCAAGAAGACATAGCGCGTGAGGAACGTGAGAAAGGGCGGATGCGACGTGAGACCAATGCGTCAGTTCTC
AGCTCACGTGGATCCAACATATCGCCAAGAGAGCCTTCACCGCACTCTGATTCACTTGGAGATAACGAGTTCATC
GGCCATGACCTTTCGCAGGACGAAGGGGGCTACCAAGCAAACGTGCACTACGGTATTTACAGTTCGGAAGAGTAT
TCGGACCCTGCCGCGGGCGACAGATTCCCAGGCACCTCTGGTTCATTCAGAAGCTCCGGGTCCCCCGATGAGCGT
GGGGAGTATTATAATGATTACGAGCACCCGCCTATTGCATATGATTATGCCAGGCGCCTCCATCATTTGCCGGCC
GATGCCAGGGTAGATGCCAGTGGTACTGGGGGATTATCGGCACCGGATGCCTATTCCCGACGGATGAGCTTTGAC
TATGGCGATGAAGGAGAATCACCATATGATCACACCCATTCTGGAGATCAATCCGATGACGAAAGCGCCCACCGA
TCCGCACACGAAGATCTGTTCTTCCACCCTGGAATGCGTCCATTGCCACCAGCACCTGTAGAGCCTGCTGGTAAT
GTTGATCTTGTGTCACATCTGATGCCTGCGGGCACATATAACCGCCACTCGGAGCAGCAAGATGACTTGGACAGC
TATTCACAGTATAACAACCCCGCCTTACTGAACTCTGCGGATTCTTATGGCGAGGCTTTGCTAAACCAGTCCCAA
GTTCCGCGGTCGTCATCTTTGTCAGCTCCCATTGGGCCTCGTACTGATGCACCCATCAGATCGAAGACCGACGCG
GACCGGCTCAGATACAGGCAGCAGCAGCAAGAACTTCTCTTGCAGCTTCAGCACAAGGACCTGCCTCATATCGAC
CCAGCGGCAGCAGCTATGACGCTGGATCTGCCAAGCATCCCGGCTGGCCGGCGCAAGAGATTCCATCCTGCAAAG
CTGTCATCGGAACAATTCAAGAAGTGTACCGAGCCGTGGGCTTTGAGCTCTCTCTTGTCCTGGATTAAAGATCTG
AGTGAGGATGAAACAGATCTCAGAGAGCAAGCAATTGCCGATGCCATGGTTGCGTTATTCACTCACAAAGTCCCC
ACCATGAATATTGCTGATGCCGAGACACTGGCTGCTCGAGTTGTGAGTGGCATGCTTGAAGAAGGTGCATTGGTA
AAAGAAGAAGAATGGGTCAAGTTTGGCTCAGGCACTCTTTCGGGTATCCTGTTCCAGATCACTGGCACTGGATGT
TACTCTCCCCGGCTCCACTTACATGAGATGCACATTGAGGGTACTGATAGCTTCGGTCGATGCTACTCTCATCAC
TGTATGCGAACATTGAAGAAGGTCAACCTCAAGGCACAGATGATGGCACCGCAGAAGAAAATCGAGGACTGGGTC
ACTTTCTACAAGGTCCCCAAGGAGGTCTGGGAAGCTCATCCGAGGAAAGAGGTCGATCGACAGAACAATCTGCAC
GAAATTGTCACTACAGAAGACTCCTACATCTCACAACTGGATGTCCTACGAGAACTATATCGTGATCAATTGGCT
AAGATGAATCCTCCCATCATTCCGGTGAAGCGATTACCCAAATTCTTGGCCGACGTGTTTGGCAAGGTTGATGCT
GTGAAGAGAGTCAACGAGGATTTCCTGTTGGCCCAGCTTAAATACCGCCAAAAAGAACAAGGGCCTTTTATCTCT
GGATTCAGTGACATCTTCCGGGAATGGATTCGCAAAGCTAAGAATGTTTACATCGACTACGCTGCAACCTTCCCA
ACGGCCAACTATCTTGTACGCAAGGAGGCTGAACGCAACCCGCACTTCAAGCAATTCCTAAACCAAGCCCGGGAA
CACAAGCTATCAAGTCGCCTTAGCTGGGATACTTTCCTCAAAGCCCCGATCACCAGAATCCAGCGGTATACTCTT
CTGTTGGCGACTGTCCACAAAAATATGGTCAAGGATTCCGAAGAAAAAGGAAATTTGGCACAGGCCATTGAAGAA
ATCAAGGTCGTTGCGCTGGAGTGTGACAACAAAGTGGGAGAGATGAACAAGAAGGCCGACTTGATGGAGTTGGCG
TCCAAGCTGCAATTGCGGCCCGACATGAAGAAGGAAGTTGAACTCAACCTTGAACACTTGGGTCGGCAGATCGTC
TATCGAGGCGAACTGCAACGTCCTGGAACCCGTACAAGATTCCTTGTTGATACACATGCCATCCTGTTCGACCAT
TATCTCGTTCTTGCTAAGGTATTCACGATGCGCGACCGGGCAGTGAAGTACGAGCGATACGATATCTCGAAATTG
CCTATCCCAATGGATCTATTGGGCCTTGAAAGCACCGACGATGATCCCGTGGTCAAATCATCGGTCCGGGGAGTT
TCGACTGTCACACCTTCCCAAGCAGGTGCTGCCAGCCCTCTTGCACATACAGGGTCTGGTGCTTCTGGAGGAAAC
GGTGCTCTTGACAACTCAAGGGATGACAAGATTCTATATCCTTTCAGAATCAAGCATCTAGGCAAAACTGGAACA
TATACTCTCTACGCCTTTTCAGCGCAAAGCCGCCTGGAATGGTGCCAAAAGATCATCGAAGCGAAGACAAAGCAT
GCTGCTGCTCTCTTCTCGCAAAATGCCGAGCCATTCCGACTGCGCGTGCTTGCGGACACTGCGTTCGCATACTCT
GATCATACACCCGGCTCTAAAAGTGTCACCATCAAGGGCACCCCTCTCCATCGTGCGATTGTGGAGGTCGAGAAA
CAATATGAAAGCTCTAAAGCTCGCCCTCCTGCGATATGCAAGACTGCAGTCAACTGTGCCACGGTGTTCCAACAG
CCACCTGGGCGGATTATGTGTGCAATTGGCACGGACTATGGAGTTTACATGTCCGAGCTCAATAACCCCAGGGGT
TGGTACAGGGCTATTCCCATCACACGGGTCACACAAGTTGCTGTCTTTGAGGATTTCAATTTGCTGTTGTTGATT
GCCGATCGGTCTTTGATTGCATACCACCTCGACGTGGTCTGTCCCGCCAATGGGAAAACCTCCCAATCATCTCAG
GATTCTGCCCGACGAGCACCGCAGAAGCTGTCTGGAAATCGTGAAGTGGGCTTCTTTGCCGCTGGTCGCCTGAAG
GACCGCTACTTGGTCTTATACAAGAAGCGTGAGGGTTTGTCGTCTACGTTCAAGGTTCTCGAGCCCGTCCTGCAA
AAATCATCCACAAATAAGGGCCGCCTGTTCTCACGTCGCTCGCAAACGGAGTTCTTCCGCGATTACGACGAGTTC
TACATCCCTGCCGAGACCTACCGAATTAACATGTTCCACTCCTCGCTTGCCATCTCAACCCAAAAGGGCATTGAA
GTCCTCACCCTTGACAAGAAACTTTCATGGTCTGTCCCAGATTTTAGCTCCAACGATACTGGAGATGCACACGAT
ACCCTCCACAGCATTGCCAATCGCATCAGCGGGCTCAAGCCGCTAGGCATGTTCCGTCTCAGCGAGAGCGAGTTC
CTAGTAGCTTACCAGCAGTGTGCTGTGTACGTCAACAAGCACGGCGACGTCTCTCGCAGTGTAGTCATGGAGTTC
GTGGGCAGCGCACACACAGCCTGTCTCTATGGCAAATTCCTAATTCTCTTCAACGACGACTTCGTCGAAGTCCGC
AACGCAATGAACGGTCGCTTACGCCAGGTTATTCCGGGCCACAACGTCGTCTGCATTGACGACGGTAGCAAGGTG
CCTGGCTCGCTCAACGGCAATGCACAAGCCAACATCGGTGGCTCGATGGGTCTTTCAAGCGGCTTCTCTGGCGCG
GCCAATGGCTCCCCGGGCCCCACGGGCATGGGCAACACGGTCAAAATCTGCATGCAGCATCCAGAGTATGAGCGA
AGCCAGCTTGCCTTGGAACTTGTCGAAAATGAGGGGCAAAAAGACTAA
Gene >Pro_DTO377G3_2|g3439.t1
ATGTCGCAATATCCAAACGGTCAACAGGCATACTATGGCCAATCTACAAACCCCCAAGCCCCTACTCAACCATCC
ACCGGCCACTATGACAATTATACCCCCGCGCCGGACAGACATCTGCCTCGAAGGATGCCGAGTTACAATGCCGGG
GATGATTCTGGATTCTTCAACCCTGTCCAGACCCAGAATATGAGAGCGACCGAAGAAAACAGCCAGTATGCAGCA
CAAGGCGGTGGTTATGGTGGCAGCGCGGGACAGGGTGGCTACAATGATGTGCAGAGAGCCACTGAAGACGACAGA
GACTCGAGATATTCGCGGACTTCCTCAGACGCCATGTCGCGTATGTCTCCGAGTCGGGCCTCTTCGCAAACCTCC
ACTATGTCTTATCAATACCAATACTCTGGAGCACCCTCGTCCCAGACGGCCTACAACCCGCAGCAATACGGCCTT
CCACACACGCAGTCGCAACCGGTTCTCGCTTATAACCCCCAGACGTACACTGGCTCCAGCAATGCTTCATACGCC
GGTCCCGCCTTGGGCCATCAACCATATAATCCTGCGGCATACCAGTCTACCGCAATGTCGGGAATGAGCTCTCCG
GTTCTACCTAGAAGGCAGAGCGCAGCTTCACACTACGGGCAGACACCGCCGACTCCACAATCGTATGGCTTTTCC
CAACAATCACCGCTTCCACCGCCAAGGGGCGCCGATCATCCGTATGGAGGACGTCCGTACCAACCCATGTCACCG
GTCACCTCGCCTTCCTATGTTCCCTCAAGCTCCCCGGGCATAATGCATATGCCTCCGCCTACATCACGTTCTTAT
TACAGCAACCCACAAGGGGCGTCGTATGATCTGCCATCTCCTCGGTATACCCCAGCGATCCCAAGCGGTTCCTTC
GAAGAGCAGCCTCCGGCGCCTCCAGTTCATCAGACTCAAGCAAATGGCTTGTACGGCAAGCGGCCAAGTGTAGCA
GGGCGAACCCTGCCGACGCCCCCTGTGCAGCTAGACTTGCCTCAACATCCGAGGCGAACTGAGACGTTGACTCGA
CACCCCCAGTCCCGGCCTCTTCCTGGACCCCCAGTCGATGAAGCTGGGCTAGATGGCAATCGTTGGCCAGCGGAA
CCTCCTATGGCATATGAAAATGTGCTCAGAGAAGATGAGGACTCTCAGAACTTTTCCCGTCACGGCTCTAGAGCA
TCCCATGCTAGCTCCCATTCACGCATGCAGTTCTTGCCGGATGAGGAACAAACCCACACCAACGGTAATATAGAG
ACAGACACTGGTCATATGATAAATGACGATGCCTACAGTGAGGAAAGCGACCCAGAGGCTGCTGCTGGTTTGATT
ATGTTGCAAGAAGACATAGCGCGTGAGGAACGTGAGAAAGGGCGGATGCGACGTGAGACCAATGCGTCAGTTCTC
AGCTCACGTGGATCCAACATATCGCCAAGAGAGCCTTCACCGCACTCTGATTCACTTGGAGATAACGAGTTCATC
GGCCATGACCTTTCGCAGGACGAAGGGGGCTACCAAGCAAACGTGCACTACGGTATTTACAGTTCGGAAGAGTAT
TCGGACCCTGCCGCGGGCGACAGATTCCCAGGCACCTCTGGTTCATTCAGAAGCTCCGGGTCCCCCGATGAGCGT
GGGGAGTATTATAATGATTACGAGCACCCGCCTATTGCATATGATTATGCCAGGCGCCTCCATCATTTGCCGGCC
GATGCCAGGGTAGATGCCAGTGGTACTGGGGGATTATCGGCACCGGATGCCTATTCCCGACGGATGAGCTTTGAC
TATGGCGATGAAGGAGAATCACCATATGATCACACCCATTCTGGAGATCAATCCGATGACGAAAGCGCCCACCGA
TCCGCACACGAAGATCTGTTCTTCCACCCTGGAATGCGTCCATTGCCACCAGCACCTGTAGAGCCTGCTGGTAAT
GTTGATCTTGTGTCACATCTGATGCCTGCGGGCACATATAACCGCCACTCGGAGCAGCAAGATGACTTGGACAGC
TATTCACAGTATAACAACCCCGCCTTACTGAACTCTGCGGATTCTTATGGCGAGGCTTTGCTAAACCAGTCCCAA
GTTCCGCGGTCGTCATCTTTGTCAGCTCCCATTGGGCCTCGTACTGATGCACCCATCAGATCGAAGACCGACGCG
GACCGGCTCAGATACAGGCAGCAGCAGCAAGAACTTCTCTTGCAGCTTCAGCACAAGGACCTGCCTCATATCGAC
CCAGCGGCAGCAGCTATGACGCTGGATCTGCCAAGCATCCCGGCTGGCCGGCGCAAGAGATTCCATCCTGCAAAG
CTGTCATCGGAACAATTCAAGAAGTGTACCGAGCCGTGGGCTTTGAGCTCTCTCTTGTCCTGGATTAAAGATCTG
AGTGAGGATGAAACAGATCTCAGAGAGCAAGCAATTGCCGATGCCATGGTTGCGTTATTCACTCACAAAGTCCCC
ACCATGAATATTGCTGATGCCGAGACACTGGCTGCTCGAGTTGTGAGTGGCATGCTTGAAGAAGGTGCATTGGTA
AAAGAAGAAGAATGGGTCAAGTTTGGCTCAGGCACTCTTTCGGGTATCCTGTTCCAGATCACTGGCACTGGATGT
TACTCTCCCCGGCTCCACTTACATGAGATGCACATTGAGGGTACTGATAGCTTCGGTCGATGCTACTCTCATCAC
TGTATGCGAACATTGAAGAAGGTCAACCTCAAGGCACAGATGATGGCACCGCAGAAGAAAATCGAGGACTGGGTC
ACTTTCTACAAGGTCCCCAAGGAGGTCTGGGAAGCTCATCCGAGGAAAGAGGTCGATCGACAGAACAATCTGCAC
GAAATTGTCACTACAGAAGACTCCTACATCTCACAACTGGATGTCCTACGAGAACTATATCGTGATCAATTGGCT
AAGATGAATCCTCCCATCATTCCGGTGAAGCGATTACCCAAATTCTTGGCCGACGTGTTTGGCAAGGTTGATGCT
GTGAAGAGAGTCAACGAGGATTTCCTGTTGGCCCAGCTTAAATACCGCCAAAAAGAACAAGGGCCTTTTATCTCT
GGATTCAGTGACATCTTCCGGGAATGGATTCGCAAAGCTAAGAATGTTTACATCGACTACGCTGCAACCTTCCCA
ACGGCCAACTATCTTGTACGCAAGGAGGCTGAACGCAACCCGCACTTCAAGCAATTCCTAAACCAAGCCCGGGAA
CACAAGCTATCAAGTCGCCTTAGCTGGGATACTTTCCTCAAAGCCCCGATCACCAGAATCCAGCGGTATACTCTT
CTGTTGGCGACTGTCCACAAAAATATGGTCAAGGATTCCGAAGAAAAAGGAAATTTGGCACAGGCCATTGAAGAA
ATCAAGGTCGTTGCGCTGGAGTGTGACAACAAAGTGGGAGAGATGAACAAGAAGGCCGACTTGATGGAGTTGGCG
TCCAAGCTGCAATTGCGGCCCGACATGAAGAAGGAAGTTGAACTCAACCTTGAACACTTGGGTCGGCAGATCGTC
TATCGAGGCGAACTGCAACGTCCTGGAACCCGTACAAGATTCCTTGTTGATACACATGCCATCCTGTTCGACCAT
TATCTCGTTCTTGCTAAGGTATTCACGATGCGCGACCGGGCAGTGAAGTACGAGCGATACGATATCTCGAAATTG
CCTATCCCAATGGATCTATTGGGCCTTGAAAGCACCGACGATGATCCCGTGGTCAAATCATCGGTCCGGGGAGTT
TCGACTGTCACACCTTCCCAAGCAGGTGCTGCCAGCCCTCTTGCACATACAGGGTCTGGTGCTTCTGGAGGAAAC
GGTGCTCTTGACAACTCAAGGGATGACAAGATTCTATATCCTTTCAGAATCAAGCATCTAGGCAAAACTGGAACA
TATACTCTCTACGCCTTTTCAGCGCAAAGCCGCCTGGAATGGTGCCAAAAGATCATCGAAGCGAAGACAAAGCAT
GCTGCTGCTCTCTTCTCGCAAAATGCCGAGCCATTCCGACTGCGCGTGCTTGCGGACACTGCGTTCGCATACTCT
GATCATACACCCGGCTCTAAAAGTGTCACCATCAAGGGCACCCCTCTCCATCGTGCGATTGTGGAGGTCGAGAAA
CAATATGAAAGCTCTAAAGCTCGCCCTCCTGCGATATGCAAGACTGCAGTCAACTGTGCCACGGTGTTCCAACAG
CCACCTGGGCGGATTATGTGTGCAATTGGCACGGACTATGGAGTTTACATGTCCGAGCTCAATAACCCCAGGGGT
TGGTACAGGGCTATTCCCATCACACGGGTCACACAAGTTGCTGTCTTTGAGGATTTCAATTTGCTGTTGTTGATT
GCCGATCGGTCTTTGATTGCATACCACCTCGACGTGGTCTGTCCCGCCAATGGGAAAACCTCCCAATCATCTCAG
GATTCTGCCCGACGAGCACCGCAGAAGCTGTCTGGAAATCGTGAAGTGGGCTTCTTTGCCGCTGGTCGCCTGAAG
GACCGCTACTTGGTCTTATACAAGAAGCGTGAGGGTTTGTCGTCTACGTTCAAGGTATATATATTCGCAGCAAAC
TCGATAAAGTAACAGCAAACTCACATACAAAATTTAGGTTCTCGAGCCCGTCCTGCAAAAATCATCCACAAATAA
GGGCCGCCTGTTCTCACGTCGCTCGCAAACGGAGTTCTTCCGCGATTACGACGAGTTCTACATCCCTGCCGAGAC
CTACCGAATTAACATGTTCCACTCCTCGCTTGCCATCTCAACCCAAAAGGGCATTGAAGTCCTCACCCTTGACAA
GAAACTTTCATGGTCTGTCCCAGATTTTAGCTCCAACGATACTGGAGATGCACACGATACCCTCCACAGCATTGC
CAATCGCATCAGCGGGCTCAAGCCGCTAGGCATGTTCCGTCTCAGCGAGAGCGAGTTCCTAGTAGCTTACCAGCA
GTGTGCTGTGTACGTCAACAAGCACGGCGACGTCTCTCGCAGTGTAGTCATGGAGTTCGTGGGCAGCGCACACAC
AGCCTGTCTCTATGGCAAATTCCTAATTCTCTTCAACGACGACTTCGTCGAAGTCCGCAACGCAATGAACGGTCG
CTTACGCCAGGTTATTCCGGGCCACAACGTCGTCTGCATTGACGACGGTAGCAAGGTGCCTGGCTCGCTCAACGG
CAATGCACAAGCCAACATCGGTGGCTCGATGGGTCTTTCAAGCGGCTTCTCTGGCGCGGCCAATGGCTCCCCGGG
CCCCACGGGCATGGGCAACACGGTCAAAATCTGCATGCAGCATCCAGAGTATGAGCGAAGCCAGCTTGCCTTGGA
ACTTGTCGAAAATGAGGGGCAAAAAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail