Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3437.t1
Gene name
Locationscaffold_05:681275..682496
Strand+
Gene length (bp)1221
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.998743

Transmembrane Domains

Domain # Start End Length
1 307 329 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 293.00 175.93 410.06
5d_25C Five days - 25 degrees Celsius 344.61 204.71 484.52
7d_25C Seven days - 25 degrees Celsius 287.19 171.07 403.31
10d_25C Ten days - 25 degrees Celsius 381.22 224.22 538.21
7d_15C Seven days - 15 degrees Celsius 287.02 171.29 402.76
7d_30C Seven days - 30 degrees Celsius 276.32 165.92 386.71

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.546862 no
3d_25C 7d_25C 0.956573 no
3d_25C 7d_15C 0.955797 no
3d_25C 7d_30C 0.859551 no
3d_25C 10d_25C 0.277854 no
5d_25C 7d_25C 0.497067 no
5d_25C 7d_15C 0.495784 no
5d_25C 7d_30C 0.376359 no
5d_25C 10d_25C 0.738791 no
7d_25C 7d_15C 0.998280 no
7d_25C 7d_30C 0.911551 no
7d_25C 10d_25C 0.239402 no
7d_15C 7d_30C 0.912503 no
7d_15C 10d_25C 0.237502 no
7d_30C 10d_25C 0.160909 no

Orthologs

Orthofinder run ID2
Orthogroup3213
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g3698.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g1011.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g3761.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g5242.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g5836.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g5317.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g8317.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g4286.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g6022.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g1639.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g5329.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g5444.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g3019.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g602.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g3931.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g5036.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g7242.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g6070.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g7049.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g5579.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g4190.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g5021.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g2616.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g6106.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g8110.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g2786.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g6176.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g6342.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g6056.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g6721.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g3013.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g8012.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g7572.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g3437.t1 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3437.t1
MFVRSLLLGGAAALGASAMLVVPEMEPKVDIIEDGFVNIHPMLLEDVRHAIVDLPCSECPLRETNDEGAVIWTEG
KPSSLTLDFSIEDNRLLANGRQIFPPAPPIPILAVQQNEEGEDSAPMPVGYALEIMPMAVPSDEPGYELLDIRFT
VLDLETHPVPVDTVAITVLQDPNGELFIARTEIESNTPASDRLSWKECHGKAKCLQELLVSRIRGLLAGAKARVM
GMAKSGHKGCHGKHEGKIMGHHEEDHDDMPYPPPPPFGKEGSGREKFGPGGHHAHAHGSARPHHHHPHHGAFART
FSRIVHFIIVPAVLGVLAGLTASAIGMLVGQAVVFLWQRYRGTTSSERKAAWEDGEACEKQGLMTSPSEEVLPEY
TEPSQVRGSLDKN*
Coding >Pro_DTO377G3_2|g3437.t1
ATGTTTGTGCGCTCCCTTTTGCTGGGTGGCGCCGCTGCTCTCGGCGCCAGTGCCATGCTGGTCGTCCCCGAGATG
GAACCTAAAGTCGATATTATTGAAGATGGATTTGTTAATATCCACCCTATGCTTCTGGAGGACGTTCGTCATGCG
ATTGTTGACCTGCCTTGCTCTGAATGTCCTCTTCGTGAAACCAATGACGAAGGTGCTGTTATCTGGACGGAGGGC
AAACCATCATCTCTGACTCTGGATTTCTCGATCGAGGACAACCGCCTGTTGGCCAACGGCCGCCAAATATTCCCA
CCGGCTCCGCCCATCCCGATTCTTGCTGTGCAACAAAATGAAGAGGGAGAGGACTCCGCCCCCATGCCTGTTGGG
TATGCGCTTGAAATCATGCCGATGGCCGTACCATCCGACGAGCCGGGATACGAACTCCTAGATATTCGATTCACT
GTTCTCGACCTGGAAACCCACCCCGTCCCTGTCGATACTGTGGCGATCACCGTCCTACAGGATCCCAACGGCGAG
CTCTTCATCGCTCGGACTGAAATCGAAAGCAACACCCCTGCTTCCGATCGCCTGTCTTGGAAGGAGTGCCACGGC
AAGGCCAAATGCCTGCAAGAACTTCTGGTCTCTCGCATTCGGGGCCTCTTGGCTGGCGCCAAGGCTCGTGTGATG
GGCATGGCCAAATCCGGCCACAAGGGCTGCCATGGCAAACACGAGGGCAAGATAATGGGCCACCACGAAGAAGAC
CATGACGATATGCCTTACCCTCCCCCGCCTCCTTTCGGGAAGGAGGGTTCTGGGCGTGAAAAGTTCGGCCCCGGT
GGTCATCATGCCCACGCCCACGGCTCCGCTCGTCCCCACCATCACCACCCGCACCACGGCGCTTTCGCCCGCACT
TTTTCACGCATTGTTCACTTTATCATTGTCCCGGCTGTTTTGGGTGTCCTGGCTGGACTGACCGCAAGTGCCATT
GGCATGCTGGTCGGCCAGGCTGTGGTTTTCCTCTGGCAACGCTACCGCGGTACCACTTCTTCGGAGCGCAAGGCC
GCCTGGGAGGATGGCGAGGCCTGCGAAAAGCAGGGTCTTATGACCAGTCCCTCCGAGGAAGTCCTTCCTGAATAC
ACAGAGCCTTCGCAGGTCCGAGGCTCGCTCGACAAGAACTAA
Transcript >Pro_DTO377G3_2|g3437.t1
ATGTTTGTGCGCTCCCTTTTGCTGGGTGGCGCCGCTGCTCTCGGCGCCAGTGCCATGCTGGTCGTCCCCGAGATG
GAACCTAAAGTCGATATTATTGAAGATGGATTTGTTAATATCCACCCTATGCTTCTGGAGGACGTTCGTCATGCG
ATTGTTGACCTGCCTTGCTCTGAATGTCCTCTTCGTGAAACCAATGACGAAGGTGCTGTTATCTGGACGGAGGGC
AAACCATCATCTCTGACTCTGGATTTCTCGATCGAGGACAACCGCCTGTTGGCCAACGGCCGCCAAATATTCCCA
CCGGCTCCGCCCATCCCGATTCTTGCTGTGCAACAAAATGAAGAGGGAGAGGACTCCGCCCCCATGCCTGTTGGG
TATGCGCTTGAAATCATGCCGATGGCCGTACCATCCGACGAGCCGGGATACGAACTCCTAGATATTCGATTCACT
GTTCTCGACCTGGAAACCCACCCCGTCCCTGTCGATACTGTGGCGATCACCGTCCTACAGGATCCCAACGGCGAG
CTCTTCATCGCTCGGACTGAAATCGAAAGCAACACCCCTGCTTCCGATCGCCTGTCTTGGAAGGAGTGCCACGGC
AAGGCCAAATGCCTGCAAGAACTTCTGGTCTCTCGCATTCGGGGCCTCTTGGCTGGCGCCAAGGCTCGTGTGATG
GGCATGGCCAAATCCGGCCACAAGGGCTGCCATGGCAAACACGAGGGCAAGATAATGGGCCACCACGAAGAAGAC
CATGACGATATGCCTTACCCTCCCCCGCCTCCTTTCGGGAAGGAGGGTTCTGGGCGTGAAAAGTTCGGCCCCGGT
GGTCATCATGCCCACGCCCACGGCTCCGCTCGTCCCCACCATCACCACCCGCACCACGGCGCTTTCGCCCGCACT
TTTTCACGCATTGTTCACTTTATCATTGTCCCGGCTGTTTTGGGTGTCCTGGCTGGACTGACCGCAAGTGCCATT
GGCATGCTGGTCGGCCAGGCTGTGGTTTTCCTCTGGCAACGCTACCGCGGTACCACTTCTTCGGAGCGCAAGGCC
GCCTGGGAGGATGGCGAGGCCTGCGAAAAGCAGGGTCTTATGACCAGTCCCTCCGAGGAAGTCCTTCCTGAATAC
ACAGAGCCTTCGCAGGTCCGAGGCTCGCTCGACAAGAACTAA
Gene >Pro_DTO377G3_2|g3437.t1
ATGTTTGTGCGCTCCCTTTTGCTGGGTGGCGCCGCTGCTCTCGGCGCCAGTGCCATGCTGGTCGTCCCCGAGATG
GAACCTAAAGTCGATATTATTGAAGATGGATTTGTTAATATCCACCCTATGCTTCTGGAGGACGTTCGTCATGCG
ATTGTTGACCTGCCTTGCTCTGAATGTCCTCTTCGTGAAACCAATGACGAAGGTGCTGTTATCTGGACGGAGGGC
AAACCATCATCTCTGGTAAGAATGACAAAATGCGTTTATTCATTCGAACTGGCTAACAAACTCTCATAGACTCTG
GATTTCTCGATCGAGGACAACCGCCTGTTGGCCAACGGCCGCCAAATATTCCCACCGGCTCCGCCCATCCCGATT
CTTGCTGTGCAACAAAATGAAGAGGGAGAGGACTCCGCCCCCATGCCTGTTGGGTATGCGCTTGAAATCATGCCG
ATGGCCGTACCATCCGACGAGCCGGGATACGAACTCCTAGATATTCGATTCACTGTTCTCGACCTGGAAACCCAC
CCCGTCCCTGTCGATACTGTGGCGATCACCGTCCTACAGGATCCCAACGGCGAGCTCTTCATCGCTCGGACTGAA
ATCGAAAGCAACACCCCTGCTTCCGATCGCCTGTCTTGGAAGGAGTGCCACGGCAAGGCCAAATGCCTGCAAGAA
CTTCTGGTCTCTCGCATTCGGGGCCTCTTGGCTGGCGCCAAGGCTCGTGTGATGGGCATGGCCAAATCCGGCCAC
AAGGGCTGCCATGGCAAACACGAGGGCAAGATAATGGGCCACCACGAAGAAGACCATGACGATATGCCTTACCCT
CCCCCGCCTCCTTTCGGGAAGGAGGGTTCTGGGCGTGAAAAGTTCGGCCCCGGTGGTCATCATGCCCACGCCCAC
GGCTCCGCTCGTCCCCACCATCACCACCCGCACCACGGCGCTTTCGCCCGCACTTTTTCACGCATTGTTCACTTT
ATCATTGTCCCGGCTGTTTTGGGTGTCCTGGCTGGACTGACCGCAAGTGCCATTGGCATGCTGGTCGGCCAGGCT
GTGGTTTTCCTCTGGCAACGCTACCGCGGTACCACTTCTTCGGAGCGCAAGGCCGCCTGGGAGGATGGCGAGGCC
TGCGAAAAGCAGGGTCTTATGACCAGTCCCTCCGAGGAAGTCCTTCCTGAATACACAGAGCCTTCGCAGGTCCGA
GGCTCGCTCGACAAGAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail