Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3428.t1
Gene name
Locationscaffold_05:657522..658056
Strand+
Gene length (bp)534
Transcript length (bp)207
Coding sequence length (bp)207
Protein length (aa) 69

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 8.98 0.00 21.25
5d_25C Five days - 25 degrees Celsius 3.20 0.60 5.79
7d_25C Seven days - 25 degrees Celsius 10.40 0.00 24.17
10d_25C Ten days - 25 degrees Celsius 3.84 0.82 6.85
7d_15C Seven days - 15 degrees Celsius 7.47 0.00 18.48
7d_30C Seven days - 30 degrees Celsius 3.33 0.66 6.00

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.397979 no
3d_25C 7d_25C 0.901045 no
3d_25C 7d_15C 0.878130 no
3d_25C 7d_30C 0.425272 no
3d_25C 10d_25C 0.468076 no
5d_25C 7d_25C 0.308581 no
5d_25C 7d_15C 0.478030 no
5d_25C 7d_30C 0.950766 no
5d_25C 10d_25C 0.917014 no
7d_25C 7d_15C 0.756107 no
7d_25C 7d_30C 0.332706 no
7d_25C 10d_25C 0.372178 no
7d_15C 7d_30C 0.514844 no
7d_15C 10d_25C 0.594010 no
7d_30C 10d_25C 0.943872 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3428.t1
MKSCSTRTANCPIIFIAHSLGGTIVSSVLLYADSAQETPTTDLRSIILPTQSLTLSTNRNWTRSVELR*
Coding >Pro_DTO377G3_2|g3428.t1
ATGAAGTCTTGTTCAACGCGGACAGCCAATTGTCCGATTATATTTATTGCACATAGTCTCGGGGGAACTATAGTT
AGCAGCGTCCTGCTTTATGCCGACTCAGCACAAGAAACCCCTACTACGGACCTTCGCAGCATCATACTTCCAACA
CAGTCGTTGACTTTGTCAACAAATCGTAATTGGACCAGGTCAGTTGAGTTACGTTGA
Transcript >Pro_DTO377G3_2|g3428.t1
ATGAAGTCTTGTTCAACGCGGACAGCCAATTGTCCGATTATATTTATTGCACATAGTCTCGGGGGAACTATAGTT
AGCAGCGTCCTGCTTTATGCCGACTCAGCACAAGAAACCCCTACTACGGACCTTCGCAGCATCATACTTCCAACA
CAGTCGTTGACTTTGTCAACAAATCGTAATTGGACCAGGTCAGTTGAGTTACGTTGA
Gene >Pro_DTO377G3_2|g3428.t1
ATGAAGTCTTGTTCAACGCGGACAGCCAATTGTCCGATTATATTTATTGCACATAGTCTCGGGGGAACTATAGTT
AGCAGCGTAAGTTTCACCATTCTACATAAGAGAGTTATCATTCACCATAATTAGGTCCTGCTTTATGCCGACTCA
GCACAAGAAACCCCTACTACGGACCTTCGCAGCATCATACTTCCAAGTTGCGGAGCGATCTTCATAGGGACACCA
GAGCTAGATTCACGGCTCATTGAACTGCAAAGCTACTTAGATAATGCCAAAGGATTGAGTAAGAGTCCAGCCATA
CTTATAAGGAAGCACAGTCGTTGGTAATTATATTATAGCGCTACCCATCAATCAACCAACAGATTGGACTTTACA
TGTTCATGGAAGACTAGACTTTGTCAACAAATCGTAATTGGACCAGGTAAGAGAATTATCCTTACCCAGCCGTGA
ACTATCTGCTTACACTTTGCTTGTTGTCTTTGCTTTGCTGGTGCTAATTCTTGTTTTCTTGTTAGGTCAGTTGAG
TTACGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail