Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3427.t1
Gene name
Locationscaffold_05:653711..656905
Strand-
Gene length (bp)3194
Transcript length (bp)3033
Coding sequence length (bp)3033
Protein length (aa) 1011

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 3.4E-122 41 493
PF10334 ArAE_2 Aromatic acid exporter family member 2 6.6E-65 791 998
PF13515 FUSC_2 Fusaric acid resistance protein-like 4.8E-10 645 787

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 98 120 22
3 176 193 17
4 203 225 22
5 232 251 19
6 628 650 22
7 657 679 22
8 683 702 19
9 709 728 19
10 733 752 19
11 769 791 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3427.t1
MTDIELSQRDALEDESPLTSNGEGSSAPVKPAQAPKAGRKLPGWLDHFNARDMKVLFRCTLAAWVASLLIVITPS
LSVIGTATFFATLVLFMVPPTGIVFIFLLGTLTVIIGMALGWAWGVITMKAAMAARPAAETQANLQSLGQAAYSQ
ANSTGQAVAEVQKELIYNGWMLDARVTVVYYCLICLFIYLISRLRAKNPKLILLQILGIIIIDVTLTIGPMLPYF
SGTVPKVLIEPAAIGIGLGLVSHFIFFPRSTSHVVLDGMEGLVRLLKGPVDVTENTLLKGQVLDMADLQRIKGQT
IAAYRNLKPAMAFLPLDFSVGWWGADDIKSMKKPIRQALVSSLSLLEVHIARIGGEAKFKKLHQLTVDRDSDSDS
QANGNEKKRPREVGMRQMMEGVNLVQAMRSPEHESMLSETVEVLRKSSKDILPACQEAVEIIAESINTANKRWFG
RPSKERLNQLHERSQTVLQNLQALRTSFASETTDRLIQTHAEIFDEKGMLKALDKTSMPRVRGIMMGMVFEEQVL
GVADGWERVLRQLVVLLKERQKIRLWLPKGLRYALNWVCRKNAVAPIPAADDPIVDPDVAETQSKAAQLHLRMSR
GYRVHRGSSFGRAIIGTYHWFINPEGLYAMRMVAVTIALAIPAAIPHTAGFYYREKGIWALIMGQTTLVIYMADF
TFSLICRAIGTVVGGVLGLVVWYIGSGHGKGNPYGLAAIMAVALTILMWARIFTSPAFLQATIMAGATYILVVGY
SFEDTHIPTYGNPGWGYSVFWRRLVLVLIGSAAALIVQLFPRPPSASRHICKSLSNVIRSLSDHYALLLSCWGQG
REEGLAAEKLALNLAETITALDGPIALLRFEFSSSPFDSDRLGQVKALCQELNQNIARLLYLSASLPEHLQTRLA
RQVGLLDHHNIGDIMAVLGVVEQSLKTGDPLPEMLPTPLLNRCHDYWKSHQTDIILSKELIRDENYRRFCVAISA
YLKFLAAVDDLVLVMKGTLGESHIVSRDLLHEPNV*
Coding >Pro_DTO377G3_2|g3427.t1
ATGACTGATATCGAACTCTCCCAGCGAGATGCCCTGGAGGACGAGTCCCCGCTCACCTCCAACGGTGAGGGGTCT
TCTGCGCCCGTGAAGCCAGCGCAGGCTCCAAAGGCCGGCAGGAAGCTGCCAGGATGGCTGGATCACTTCAATGCC
CGCGATATGAAGGTGCTGTTCCGTTGCACGTTGGCTGCATGGGTCGCGTCGCTTTTGATCGTGATCACTCCGTCC
TTAAGCGTCATTGGTACTGCGACTTTCTTTGCAACTCTAGTACTCTTTATGGTGCCTCCGACCGGCATTGTTTTC
ATTTTCCTTTTAGGAACTCTGACCGTTATCATTGGTATGGCTTTGGGCTGGGCCTGGGGTGTCATCACTATGAAG
GCTGCGATGGCAGCGAGACCAGCAGCCGAGACCCAGGCCAACCTTCAATCCCTAGGACAGGCCGCATACAGCCAG
GCCAATTCCACCGGACAGGCCGTGGCAGAAGTCCAGAAGGAGCTTATCTATAACGGCTGGATGCTTGACGCTCGT
GTAACAGTTGTCTACTATTGCCTAATCTGTCTGTTCATCTATTTAATCTCCCGTCTTCGGGCTAAGAACCCCAAA
CTCATTCTGTTACAGATTCTCGGAATCATCATCATCGATGTTACTCTGACTATTGGCCCGATGCTTCCATATTTC
AGCGGTACTGTCCCTAAGGTCTTGATCGAGCCTGCCGCTATTGGAATTGGGTTGGGCCTGGTCTCCCATTTTATC
TTCTTCCCTCGATCTACCTCCCACGTCGTGCTTGATGGCATGGAGGGGCTGGTGCGGTTACTCAAAGGGCCTGTG
GACGTCACGGAGAACACTCTTCTGAAAGGCCAAGTCTTGGATATGGCAGATCTTCAAAGAATCAAAGGGCAAACC
ATTGCTGCTTACAGGAATCTCAAGCCGGCCATGGCCTTTCTGCCGTTGGACTTCTCTGTCGGTTGGTGGGGTGCT
GACGACATCAAAAGCATGAAGAAACCAATTCGCCAGGCTTTGGTGAGTAGTCTGTCTCTTCTTGAAGTTCACATC
GCCCGCATCGGCGGAGAAGCCAAGTTCAAAAAGCTGCACCAGCTCACCGTGGATCGAGACTCCGACTCTGATTCC
CAAGCGAATGGAAATGAGAAAAAACGCCCACGCGAGGTTGGCATGCGCCAAATGATGGAGGGTGTTAATTTGGTA
CAAGCAATGCGAAGCCCGGAACATGAATCTATGCTATCGGAAACTGTCGAGGTATTGCGCAAGTCCAGCAAGGAT
ATCCTCCCGGCGTGTCAGGAAGCTGTTGAGATCATTGCAGAATCCATTAACACGGCCAACAAGCGTTGGTTCGGT
CGCCCTTCCAAAGAACGTCTCAATCAGTTGCACGAGCGCAGTCAGACTGTACTTCAGAATCTTCAGGCCCTGCGC
ACATCGTTCGCGTCGGAAACCACCGACCGTCTGATTCAAACACATGCGGAGATTTTCGATGAAAAAGGCATGCTC
AAGGCCCTTGACAAAACTTCAATGCCCAGAGTTAGGGGTATCATGATGGGGATGGTCTTCGAAGAGCAGGTGCTC
GGCGTCGCTGACGGGTGGGAGCGGGTCCTGCGACAACTTGTCGTCCTCCTAAAGGAACGTCAGAAGATCCGTCTG
TGGCTACCCAAGGGCTTGCGATACGCACTCAACTGGGTATGTCGTAAAAATGCCGTGGCGCCTATACCCGCGGCT
GATGACCCAATCGTCGACCCCGATGTCGCAGAGACGCAGTCCAAAGCGGCACAGCTTCATCTTCGCATGAGCAGA
GGGTATCGTGTCCACCGAGGTAGCAGCTTTGGGCGCGCTATCATCGGCACATATCATTGGTTTATCAACCCTGAA
GGTCTTTATGCAATGCGCATGGTGGCTGTCACCATCGCGCTCGCTATCCCTGCTGCGATTCCCCACACTGCGGGT
TTCTATTACCGTGAAAAAGGTATCTGGGCTCTCATCATGGGGCAGACCACACTGGTTATATACATGGCCGACTTC
ACCTTCTCCCTTATTTGTCGAGCCATTGGTACTGTTGTTGGTGGTGTCCTTGGCTTAGTTGTGTGGTACATCGGC
TCAGGTCACGGCAAAGGTAACCCGTACGGTCTTGCTGCCATCATGGCTGTTGCGCTCACCATTCTCATGTGGGCA
CGTATATTCACGTCCCCTGCTTTCCTTCAAGCTACAATCATGGCTGGTGCGACCTACATTCTGGTTGTCGGTTAC
AGTTTCGAGGATACGCACATCCCAACTTACGGCAATCCCGGATGGGGATATAGTGTTTTCTGGCGACGACTTGTG
CTTGTTCTTATTGGCTCCGCAGCGGCACTAATCGTGCAGCTCTTCCCTCGTCCGCCATCTGCGTCGAGACACATC
TGCAAGTCTCTTTCAAATGTCATCCGCTCACTGTCGGACCACTACGCGCTTCTCTTATCCTGCTGGGGACAAGGG
CGCGAAGAGGGCCTGGCCGCAGAGAAGCTAGCTCTAAATCTTGCAGAGACTATCACCGCACTGGACGGTCCCATC
GCCTTGCTGCGCTTTGAATTTTCGAGCTCGCCATTTGACAGCGATCGTCTCGGTCAGGTCAAAGCACTTTGTCAA
GAACTCAACCAGAACATTGCTCGCCTACTTTACCTATCTGCTTCGCTGCCGGAGCACCTACAGACTCGCCTCGCT
CGGCAAGTCGGTCTCCTTGATCATCACAATATCGGCGACATCATGGCTGTTCTCGGTGTGGTTGAACAATCACTC
AAGACGGGTGACCCCCTACCCGAGATGCTGCCAACGCCACTGCTCAACCGTTGCCACGATTACTGGAAGTCGCAC
CAGACAGATATTATCCTGAGCAAGGAGTTGATCCGCGACGAGAACTACCGCCGATTCTGCGTTGCCATCAGCGCA
TACCTCAAGTTCCTGGCTGCCGTGGATGACCTAGTGCTCGTGATGAAGGGCACATTGGGTGAGTCGCACATCGTC
AGCCGCGACCTGCTCCACGAACCGAATGTATAA
Transcript >Pro_DTO377G3_2|g3427.t1
ATGACTGATATCGAACTCTCCCAGCGAGATGCCCTGGAGGACGAGTCCCCGCTCACCTCCAACGGTGAGGGGTCT
TCTGCGCCCGTGAAGCCAGCGCAGGCTCCAAAGGCCGGCAGGAAGCTGCCAGGATGGCTGGATCACTTCAATGCC
CGCGATATGAAGGTGCTGTTCCGTTGCACGTTGGCTGCATGGGTCGCGTCGCTTTTGATCGTGATCACTCCGTCC
TTAAGCGTCATTGGTACTGCGACTTTCTTTGCAACTCTAGTACTCTTTATGGTGCCTCCGACCGGCATTGTTTTC
ATTTTCCTTTTAGGAACTCTGACCGTTATCATTGGTATGGCTTTGGGCTGGGCCTGGGGTGTCATCACTATGAAG
GCTGCGATGGCAGCGAGACCAGCAGCCGAGACCCAGGCCAACCTTCAATCCCTAGGACAGGCCGCATACAGCCAG
GCCAATTCCACCGGACAGGCCGTGGCAGAAGTCCAGAAGGAGCTTATCTATAACGGCTGGATGCTTGACGCTCGT
GTAACAGTTGTCTACTATTGCCTAATCTGTCTGTTCATCTATTTAATCTCCCGTCTTCGGGCTAAGAACCCCAAA
CTCATTCTGTTACAGATTCTCGGAATCATCATCATCGATGTTACTCTGACTATTGGCCCGATGCTTCCATATTTC
AGCGGTACTGTCCCTAAGGTCTTGATCGAGCCTGCCGCTATTGGAATTGGGTTGGGCCTGGTCTCCCATTTTATC
TTCTTCCCTCGATCTACCTCCCACGTCGTGCTTGATGGCATGGAGGGGCTGGTGCGGTTACTCAAAGGGCCTGTG
GACGTCACGGAGAACACTCTTCTGAAAGGCCAAGTCTTGGATATGGCAGATCTTCAAAGAATCAAAGGGCAAACC
ATTGCTGCTTACAGGAATCTCAAGCCGGCCATGGCCTTTCTGCCGTTGGACTTCTCTGTCGGTTGGTGGGGTGCT
GACGACATCAAAAGCATGAAGAAACCAATTCGCCAGGCTTTGGTGAGTAGTCTGTCTCTTCTTGAAGTTCACATC
GCCCGCATCGGCGGAGAAGCCAAGTTCAAAAAGCTGCACCAGCTCACCGTGGATCGAGACTCCGACTCTGATTCC
CAAGCGAATGGAAATGAGAAAAAACGCCCACGCGAGGTTGGCATGCGCCAAATGATGGAGGGTGTTAATTTGGTA
CAAGCAATGCGAAGCCCGGAACATGAATCTATGCTATCGGAAACTGTCGAGGTATTGCGCAAGTCCAGCAAGGAT
ATCCTCCCGGCGTGTCAGGAAGCTGTTGAGATCATTGCAGAATCCATTAACACGGCCAACAAGCGTTGGTTCGGT
CGCCCTTCCAAAGAACGTCTCAATCAGTTGCACGAGCGCAGTCAGACTGTACTTCAGAATCTTCAGGCCCTGCGC
ACATCGTTCGCGTCGGAAACCACCGACCGTCTGATTCAAACACATGCGGAGATTTTCGATGAAAAAGGCATGCTC
AAGGCCCTTGACAAAACTTCAATGCCCAGAGTTAGGGGTATCATGATGGGGATGGTCTTCGAAGAGCAGGTGCTC
GGCGTCGCTGACGGGTGGGAGCGGGTCCTGCGACAACTTGTCGTCCTCCTAAAGGAACGTCAGAAGATCCGTCTG
TGGCTACCCAAGGGCTTGCGATACGCACTCAACTGGGTATGTCGTAAAAATGCCGTGGCGCCTATACCCGCGGCT
GATGACCCAATCGTCGACCCCGATGTCGCAGAGACGCAGTCCAAAGCGGCACAGCTTCATCTTCGCATGAGCAGA
GGGTATCGTGTCCACCGAGGTAGCAGCTTTGGGCGCGCTATCATCGGCACATATCATTGGTTTATCAACCCTGAA
GGTCTTTATGCAATGCGCATGGTGGCTGTCACCATCGCGCTCGCTATCCCTGCTGCGATTCCCCACACTGCGGGT
TTCTATTACCGTGAAAAAGGTATCTGGGCTCTCATCATGGGGCAGACCACACTGGTTATATACATGGCCGACTTC
ACCTTCTCCCTTATTTGTCGAGCCATTGGTACTGTTGTTGGTGGTGTCCTTGGCTTAGTTGTGTGGTACATCGGC
TCAGGTCACGGCAAAGGTAACCCGTACGGTCTTGCTGCCATCATGGCTGTTGCGCTCACCATTCTCATGTGGGCA
CGTATATTCACGTCCCCTGCTTTCCTTCAAGCTACAATCATGGCTGGTGCGACCTACATTCTGGTTGTCGGTTAC
AGTTTCGAGGATACGCACATCCCAACTTACGGCAATCCCGGATGGGGATATAGTGTTTTCTGGCGACGACTTGTG
CTTGTTCTTATTGGCTCCGCAGCGGCACTAATCGTGCAGCTCTTCCCTCGTCCGCCATCTGCGTCGAGACACATC
TGCAAGTCTCTTTCAAATGTCATCCGCTCACTGTCGGACCACTACGCGCTTCTCTTATCCTGCTGGGGACAAGGG
CGCGAAGAGGGCCTGGCCGCAGAGAAGCTAGCTCTAAATCTTGCAGAGACTATCACCGCACTGGACGGTCCCATC
GCCTTGCTGCGCTTTGAATTTTCGAGCTCGCCATTTGACAGCGATCGTCTCGGTCAGGTCAAAGCACTTTGTCAA
GAACTCAACCAGAACATTGCTCGCCTACTTTACCTATCTGCTTCGCTGCCGGAGCACCTACAGACTCGCCTCGCT
CGGCAAGTCGGTCTCCTTGATCATCACAATATCGGCGACATCATGGCTGTTCTCGGTGTGGTTGAACAATCACTC
AAGACGGGTGACCCCCTACCCGAGATGCTGCCAACGCCACTGCTCAACCGTTGCCACGATTACTGGAAGTCGCAC
CAGACAGATATTATCCTGAGCAAGGAGTTGATCCGCGACGAGAACTACCGCCGATTCTGCGTTGCCATCAGCGCA
TACCTCAAGTTCCTGGCTGCCGTGGATGACCTAGTGCTCGTGATGAAGGGCACATTGGGTGAGTCGCACATCGTC
AGCCGCGACCTGCTCCACGAACCGAATGTATAA
Gene >Pro_DTO377G3_2|g3427.t1
ATGACTGATATCGAACTCTCCCAGCGAGATGCCCTGGAGGACGAGTCCCCGCTCACCTCCAACGGTGAGGGGTCT
TCTGCGCCCGTGAAGCCAGCGCAGGCTCCAAAGGCCGGCAGGAAGCTGCCAGGATGGCTGGATCACTTCAATGCC
CGCGATATGAAGGTGCTGTTCCGTTGCACGTTGGCTGCATGGGTCGCGTCGCTTTTGATCGTGATCACTCCGTCC
TTAAGCGTCATTGGTACTGCGACTTTCTTTGCAACGTGAGCGCATCTATATTTTACTCTCGGTATCAATTGCTAA
TCCTATCGCGATCAGTCTAGTACTCTTTATGGTGCCTCCGACCGGCATTGTTTTCATTTTCCTTTTAGGAACTCT
GACCGTTATCATTGGTATGGCTTTGGGCTGGGCCTGGGGTGTCATCACTATGAAGGCTGCGATGGCAGCGAGACC
AGCAGCCGAGACCCAGGCCAACCTTCAATCCCTAGGACAGGCCGCATACAGCCAGGCCAATTCCACCGGACAGGC
CGTGGCAGAAGTCCAGAAGGAGCTTATCTATAACGGCTGGATGCTTGACGCTCGTGTAACAGTTGTCTACTATTG
CCTAATCTGTCTGTTCATCTATTTAATCGTGAGAGACTTCTTGACCCGTGCATAATGATCGCGACACTGACCCTT
TCGCGCAGTCCCGTCTTCGGGCTAAGAACCCCAAACTCATTCTGTTACAGATTCTCGGAATCATCATCATCGATG
TTACTCTGACTATTGGCCCGATGCTTCCATATTTCAGCGGTACTGTCCCTAAGGTCTTGATCGAGCCTGCCGCTA
TTGGAATTGGGTTGGGCCTGGTCTCCCATTTTATCTTCTTCCCTCGATCTACCTCCCACGTCGTGCTTGATGGCA
TGGAGGGGCTGGTGCGGTTACTCAAAGGGCCTGTGGACGTCACGGAGAACACTCTTCTGAAAGGCCAAGTCTTGG
ATATGGCAGATCTTCAAAGAATCAAAGGGCAAACCATTGCTGCTTACAGGAATCTCAAGCCGGCCATGGCCTTTC
TGCCGTTGGACTTCTCTGTCGGTTGGTGGGGTGCTGACGACATCAAAAGCATGAAGAAACCAATTCGCCAGGCTT
TGGTGAGTAGTCTGTCTCTTCTTGAAGTTCACATCGCCCGCATCGGCGGAGAAGCCAAGTTCAAAAAGCTGCACC
AGCTCACCGTGGATCGAGACTCCGACTCTGATTCCCAAGCGAATGGAAATGAGAAAAAACGCCCACGCGAGGTTG
GCATGCGCCAAATGATGGAGGGTGTTAATTTGGTACAAGCAATGCGAAGCCCGGAACATGAATCTATGCTATCGG
AAACTGTCGAGGTATTGCGCAAGTCCAGCAAGGATATCCTCCCGGCGTGTCAGGAAGCTGTTGAGATCATTGCAG
AATCCATTAACACGGCCAACAAGCGTTGGTTCGGTCGCCCTTCCAAAGAACGTCTCAATCAGTTGCACGAGCGCA
GTCAGACTGTACTTCAGAATCTTCAGGCCCTGCGCACATCGTTCGCGTCGGAAACCACCGACCGTCTGATTCAAA
CACATGCGGAGATTTTCGATGAAAAAGGCATGCTCAAGGCCCTTGACAAAACTTCAATGCCCAGAGTTAGGGGTA
TCATGATGGGGATGGTCTTCGAAGAGCAGGTGCTCGGCGTCGCTGACGGGTGGGAGCGGGTCCTGCGACAACTTG
TCGTCCTCCTAAAGGAACGTCAGAAGATCCGTCTGTGGCTACCCAAGGGCTTGCGATACGCACTCAACTGGGTAT
GTCGTAAAAATGCCGTGGCGCCTATACCCGCGGCTGATGACCCAATCGTCGACCCCGATGTCGCAGAGACGCAGT
CCAAAGCGGCACAGCTTCATCTTCGCATGAGCAGAGGGTATCGTGTCCACCGAGGTAGCAGCTTTGGGCGCGCTA
TCATCGGCACATATCATTGGTTTATCAACCCTGAAGGTCTTTATGCAATGCGCATGGTGGCTGTCACCATCGCGC
TCGCTATCCCTGCTGCGATTCCCCACACTGCGGGTTTCTATTACCGTGAAAAAGGTATCTGGGCTCTCATCATGG
GGCAGACCACACTGGTTATATACATGGCCGACTTCACCTTCTCCCTTATTTGTCGAGCCATTGGTACTGTTGTTG
GTGGTGTCCTTGGCTTAGTTGTGTGGTACATCGGCTCAGGTCACGGCAAAGGTAACCCGTACGGTCTTGCTGCCA
TCATGGCTGTTGCGCTCACCATTCTCATGTGGGCACGTATATTCACGTCCCCTGCTTTCCTTCAAGCTACAATCA
TGGCTGGTGCGACCTACATTCTGGTTGTCGGTTACAGTTTCGAGGATACGTAAGTATATGGTACCACATTGGGGA
AGCAACATGGCTGACAACTTCACAGGCACATCCCAACTTACGGCAATCCCGGATGGGGATATAGTGTTTTCTGGC
GACGACTTGTGCTTGTTCTTATTGGCTCCGCAGCGGCACTAATCGTGCAGCTCTTCCCTCGTCCGCCATCTGCGT
CGAGACACATCTGCAAGTCTCTTTCAAATGTCATCCGCTCACTGTCGGACCACTACGCGCTTCTCTTATCCTGCT
GGGGACAAGGGCGCGAAGAGGGCCTGGCCGCAGAGAAGCTAGCTCTAAATCTTGCAGAGACTATCACCGCACTGG
ACGGTCCCATCGCCTTGCTGCGCTTTGAATTTTCGAGCTCGCCATTTGACAGCGATCGTCTCGGTCAGGTCAAAG
CACTTTGTCAAGAACTCAACCAGAACATTGCTCGCCTACTTTACCTATCTGCTTCGCTGCCGGAGCACCTACAGA
CTCGCCTCGCTCGGCAAGTCGGTCTCCTTGATCATCACAATATCGGCGACATCATGGCTGTTCTCGGTGTGGTTG
AACAATCACTCAAGACGGGTGACCCCCTACCCGAGATGCTGCCAACGCCACTGCTCAACCGTTGCCACGATTACT
GGAAGTCGCACCAGACAGATATTATCCTGAGCAAGGAGTTGATCCGCGACGAGAACTACCGCCGATTCTGCGTTG
CCATCAGCGCATACCTCAAGTTCCTGGCTGCCGTGGATGACCTAGTGCTCGTGATGAAGGGCACATTGGGTGAGT
CGCACATCGTCAGCCGCGACCTGCTCCACGAACCGAATGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail