Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3408.t1
Gene name
Locationscaffold_05:594363..601682
Strand+
Gene length (bp)7319
Transcript length (bp)7152
Coding sequence length (bp)7152
Protein length (aa) 2384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 9.1E-16 98 346
PF08323 Glyco_transf_5 Starch synthase catalytic domain 4.3E-14 1147 1352

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 1062 1084 22
2 1958 1976 18
3 1991 2013 22
4 2020 2042 22
5 2052 2074 22
6 2086 2108 22
7 2128 2150 22
8 2173 2192 19
9 2207 2229 22
10 2236 2253 17
11 2268 2289 21
12 2310 2332 22
13 2352 2374 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3408.t1
MQRSAFLILSFLSVFAFAWPYDKPLAKYNLNENKSAESPIDYWGAWPDHDYHPSPDNWRMPTYTIFLDRIANGDP
TNDDINGTAFEHVVNSNQMRHGGDLEGLIDTLDYIQGMGFKVIYFAGTYLMNLPWAYDGYSPVDTTLLDMHYGTL
DDWRRTVEEIHKREMYVLVDNTLATMSNLIGFKGHLNDSADFKASEYEVQWVTDREYADFNFGNDYNESCSYPKF
WDETGYPLTTSGVQNLKGCYNSDFDQYGELEAFGNFPDWQRQLTKFASVQDRLREWHKPVRDVITQHSCLQIASL
DIDGFRFDKSVQSTLEPLSEMMAVYRECAQALGKKNFFLPGEITSGDSFGSLYLGRGRQPNQRTANAGAGIKITN
SSDGAFLRDDGLQALDASAFHYTIYRSMTRFLGMDGNLVAGFDLPTDFIEAWNEMLITNDFLNAFTGEVDPRHMY
GVSNQDNFRWPALQNGTDKYLLGLYIITLELPGIPLILWGEEQEMYVFDATAANYMFGRQPMTYQTAWWTQGCFN
LNTSKFYDFPIEKGRDGCNDITVTYDQRNPAHPLRNIMKRMFEIRAHYPVAMDGLYLETLSELTQDIYLPGSSTT
PTVTGLWSVLRSYFPAVQTDAILANETLWLVYQNGNSTVTYGGNCSDKNTSLLAPFDSGTKLKNLFYPYDELTLQ
DGPAKADNVNLYGCVRKMELLPWEYRAYVKSSNFVEPGPTVTDFYPGHDTRLLSSEDTGETLPIQLGYSKAMDCS
SITEAIYLNSTTEKNITAVLDTDSVKCANISARTTSHNFTGEIPTVWTWSANLKNVHHGIHQLTVQNVSTSGVYT
NATDKFLIRLGASDNPLISPLANYSTSLVQKSNDDLYIQHRAAGADMFRYTADFGLSWTDWTTYSGGNTTITIPA
FTGTDAQKWEGTHIRVQYFSRLTGSSDYLQEGDYASTTVRRFPHIWFNGPYNQYGYDAGMDSKMKFDSKTSRWIY
DFVYEWPAVGQLNVWGQDKEGTPDNTEVYGDVGNSSSVQKLPPSYLASNVINITILPPFPHLGWTISLNDGNLRY
ELIPVGSGWAQLVLFILFWVIPLVMGCAGVFIFIGNFYRVKLNLNGNAIKTEKFPVVLWRRMKGTFSKDNVEEIN
MAEKAPPTIMGMAGASDQRRTVLIATMEYDIQDWKIKVKIGGLGVMAQLMSQNLKHQNLIWVVPCVGDIDYPEDT
PVEPFVVTILDHPYSVKVQYHVVDNITYVLLDAPVFRQQTKAEPYPPRMDDLDSAIYYSAWNQCIAEVMRRTPSI
DLYHINDFHGCVAPLYLLPSRTIPVCLSLHNAEFQGLWALRTAQEKKEVCAVFNLPVEVATKYCQFGSVFNLLHT
GASYLRFHQRGFGAVGVSEKYGKRSLARYPIFWSLGKIGSLPNPDPSDTAALKKDPDVQVTVQSADEHANDKTQA
QKWAGLDEDPSADLLVFVGRWSKQKGVDLIADVMPAVLSARPNVQLICIGPIIDLYGKLAAIKLERIVEMFPGRV
CSKPQFTVLPPFVFSGADFALIPSRDEPFGLIAVEFGRKGALGIGSRIGGLGQMPGWWYTVESDSARHLLHQLRT
AIKSALDSTPETRKEMRENSAKQRFPVLEWVQKLEVLQRTSIQIHHQKNQLTVAGTARDTQIFWETPALRDSALV
TRPSSFQSATALDTPPLGRAPQPFQPSLLQLQAVEAQEMQVAESNRGSMLGRNLSLGRRSGPGHGRKRLFRKSQR
GSQFTEPADGDTTDADDDGTATPQEKLISQEEAMAAVNSPMEFGAHPRHSNQSGESISSTSESMRFMSRDPSPVR
LTRDLSDSAVPFAHAPNMSVLSLPSVVNDHDQPNFHLQKVDPTFTDSMGYFTRHFEQQLTNLNKKNSISDYCIEL
YLMKSERKFFYMYSDAQLKKQPKERPVTGSGSDKTDEPAPPYSLVTEGHEESNENNTDEIDLWLSRLGYKRPIAI
QRFMRWRVGNWPVYALFLGLGQIIATNSAQITLLAGQIGETAVKLYVIAAIYCVSSIAWWFLFYRFPSVIVLSLP
WFIYCMAFITIGVSPFALSDLGQAWAQNVAAGTYAAASSSGSLFFALNFGDQGAVPVKDWMFRASMIQGISQLYT
VALWYWSSRVTSAEVGGVSTVALNSWRLSAVVMPIAAVCFIIGMLLALGLPKYYRQAPGKILFFYTSLFRRRIVL
WFFFMVIVQNWFLSAAFGRNWSFLWSSQHTKPWYIVLLVLFFFIILWIAVMLLFRFLSKEHSWILPVFGLSIGAP
RWAQTWWGTSNIGHYLPWAGGLTSGAIASRCVWLWLGVLDEIQQVGLGMILLQTLTRVHVVFVLLAAQSLGSIAT
ICARGFAPNKVGPASISPAVGSSLDTVANAWFWIALFFQLLASFGFLLFYRREQLNRP*
Coding >Pro_DTO377G3_2|g3408.t1
ATGCAGCGCTCAGCTTTCCTCATACTGTCGTTTTTGAGCGTCTTTGCCTTTGCCTGGCCCTACGATAAACCACTC
GCTAAATACAATCTCAACGAAAACAAATCCGCCGAAAGCCCCATCGATTATTGGGGAGCATGGCCGGACCATGAT
TATCACCCGTCGCCAGATAACTGGCGCATGCCTACATATACAATCTTTTTGGACCGTATAGCCAACGGCGACCCG
ACCAATGACGATATCAACGGGACCGCCTTTGAGCATGTGGTCAACTCCAATCAGATGCGCCATGGAGGTGATTTG
GAGGGGTTGATAGATACGTTGGACTACATCCAGGGAATGGGATTCAAGGTCATCTACTTCGCCGGAACGTACTTG
ATGAACTTGCCCTGGGCCTACGATGGGTACTCGCCGGTCGATACCACCCTCCTTGACATGCATTATGGAACACTG
GATGACTGGAGGCGGACCGTGGAGGAGATTCACAAACGGGAGATGTATGTGTTGGTGGATAACACACTGGCAACA
ATGAGCAACCTCATCGGATTCAAAGGCCATCTGAACGATTCCGCCGATTTCAAAGCATCTGAATATGAAGTCCAA
TGGGTCACCGACCGAGAATATGCCGATTTCAACTTCGGTAACGACTATAACGAATCTTGCAGCTATCCCAAGTTC
TGGGATGAGACTGGATATCCATTAACCACCTCGGGCGTCCAAAATTTGAAGGGTTGCTATAACAGCGATTTCGAT
CAATACGGAGAGCTTGAGGCATTCGGTAATTTCCCCGACTGGCAGCGTCAACTTACCAAGTTCGCCTCCGTGCAG
GATCGTCTACGTGAATGGCACAAGCCGGTCCGCGATGTGATCACTCAACATTCCTGCCTCCAAATCGCGAGTCTA
GACATCGACGGTTTCCGCTTCGATAAGTCTGTGCAATCGACCCTCGAGCCCCTGAGTGAGATGATGGCCGTCTAC
CGTGAATGCGCGCAGGCACTCGGCAAGAAAAATTTCTTCCTCCCCGGCGAGATCACATCTGGAGACAGCTTTGGC
AGTCTCTACCTCGGCCGCGGCCGCCAACCAAACCAGCGTACAGCCAACGCAGGCGCGGGTATCAAGATCACGAAC
AGCTCGGATGGGGCGTTCCTGAGAGACGATGGGCTGCAAGCTTTGGATGCCTCCGCATTTCACTATACCATTTAC
CGTTCGATGACCCGTTTCCTAGGCATGGACGGTAACCTGGTTGCTGGCTTTGATTTGCCTACCGATTTCATCGAA
GCCTGGAATGAGATGCTCATCACTAACGATTTCCTCAATGCATTCACAGGAGAAGTTGATCCGAGACATATGTAT
GGTGTCTCGAACCAGGATAATTTCCGCTGGCCAGCTCTCCAAAATGGCACAGATAAATACCTCCTGGGTTTGTAC
ATCATCACATTGGAGCTGCCTGGAATCCCTCTCATCTTGTGGGGAGAAGAGCAGGAGATGTACGTGTTTGACGCT
ACCGCAGCGAACTATATGTTCGGTCGGCAACCCATGACGTACCAAACCGCGTGGTGGACACAAGGCTGCTTCAAC
TTGAACACCTCAAAGTTCTACGATTTCCCCATCGAAAAGGGTCGCGATGGCTGCAATGATATCACTGTCACGTAC
GACCAGCGGAATCCCGCCCATCCACTGCGTAACATCATGAAGCGCATGTTCGAGATCCGTGCGCATTACCCGGTC
GCCATGGATGGCTTGTACCTCGAAACACTCTCCGAACTGACACAAGACATCTACCTCCCTGGTTCTTCTACCACC
CCCACGGTCACTGGCCTTTGGTCTGTCCTGCGAAGCTATTTCCCTGCGGTACAAACAGACGCGATCCTGGCCAAC
GAAACTCTATGGCTTGTGTATCAGAATGGAAACTCAACCGTCACATACGGGGGCAACTGCAGCGATAAGAATACG
TCCTTATTGGCTCCATTCGACTCAGGGACAAAATTGAAGAACCTCTTTTATCCTTACGATGAGCTCACCTTGCAG
GATGGCCCCGCCAAGGCAGACAACGTCAACCTCTATGGATGCGTCAGGAAAATGGAGCTGCTTCCATGGGAATAC
CGGGCCTATGTCAAGAGCTCCAACTTCGTCGAACCCGGCCCTACCGTCACCGATTTCTATCCCGGACATGATACT
CGGTTGCTATCTTCAGAAGACACGGGCGAAACCCTGCCCATTCAGCTTGGATATTCCAAGGCAATGGACTGTAGC
AGCATCACAGAAGCCATTTACCTAAATTCTACAACAGAGAAAAACATCACCGCCGTGCTTGATACGGATAGTGTC
AAGTGCGCCAATATCTCTGCCAGGACCACCAGCCATAACTTCACCGGCGAAATCCCGACTGTTTGGACATGGTCT
GCAAACCTGAAGAACGTCCACCACGGAATCCACCAACTAACTGTCCAAAATGTTTCCACTTCCGGAGTTTACACC
AATGCGACCGACAAATTCTTGATCCGCCTAGGCGCTTCTGACAATCCCCTGATTTCTCCGCTTGCCAATTACTCT
ACCAGCCTAGTGCAAAAGTCCAACGATGACCTTTACATCCAGCACAGAGCTGCCGGTGCGGACATGTTCCGATAT
ACGGCTGATTTCGGCCTGAGCTGGACCGATTGGACGACTTATTCAGGTGGCAACACGACTATTACCATCCCAGCC
TTCACAGGTACGGACGCCCAGAAGTGGGAGGGAACTCATATCCGGGTGCAGTACTTTTCGAGGCTCACTGGAAGC
AGCGATTACCTCCAGGAAGGTGATTATGCGAGCACCACAGTCCGAAGATTCCCGCACATTTGGTTCAACGGCCCA
TATAACCAATATGGCTATGATGCAGGAATGGACAGCAAGATGAAGTTCGATTCCAAAACGTCTCGTTGGATCTAC
GACTTCGTCTACGAATGGCCAGCTGTGGGTCAGCTGAACGTTTGGGGCCAGGACAAGGAGGGCACTCCTGATAAT
ACCGAGGTCTACGGTGACGTCGGCAACTCGTCTTCAGTTCAAAAGCTTCCACCGTCCTACCTCGCATCCAACGTC
ATCAACATCACCATTCTGCCACCGTTCCCGCATCTTGGCTGGACCATCTCCCTCAACGATGGCAACCTAAGGTAC
GAACTGATTCCCGTTGGATCTGGATGGGCCCAGTTGGTCCTCTTTATTCTTTTCTGGGTTATTCCGCTTGTTATG
GGCTGCGCCGGTGTTTTCATCTTCATCGGAAACTTCTACCGGGTCAAACTCAACCTGAATGGCAATGCCATCAAG
ACCGAGAAGTTCCCGGTGGTGCTTTGGCGCAGAATGAAGGGAACGTTTTCCAAAGATAATGTCGAGGAGATCAAT
ATGGCAGAAAAGGCCCCGCCAACAATCATGGGAATGGCAGGCGCGAGCGATCAACGACGCACTGTATTGATTGCC
ACTATGGAGTATGACATTCAAGACTGGAAGATCAAAGTCAAGATTGGTGGCCTGGGAGTGATGGCGCAGCTCATG
TCCCAAAATCTGAAGCACCAGAATCTCATCTGGGTGGTCCCGTGTGTCGGCGATATTGACTACCCTGAGGATACG
CCTGTTGAACCTTTCGTGGTGACGATCCTAGATCATCCCTACTCAGTCAAGGTCCAGTATCACGTTGTCGATAAC
ATCACCTATGTTCTACTCGATGCTCCGGTTTTCCGCCAGCAGACCAAGGCCGAGCCATACCCTCCACGTATGGAT
GACCTTGACAGTGCAATTTACTATTCGGCCTGGAATCAATGTATTGCAGAGGTAATGCGGCGAACACCCTCGATT
GATCTCTATCACATCAACGACTTCCACGGCTGCGTGGCACCGCTTTACCTGCTCCCGTCGCGAACTATTCCAGTC
TGTTTGTCTCTGCACAATGCCGAGTTCCAAGGTCTTTGGGCTCTGAGGACCGCACAAGAGAAGAAAGAAGTCTGT
GCTGTGTTCAATCTCCCAGTAGAAGTGGCCACAAAATACTGTCAGTTTGGCAGCGTTTTCAACCTGCTTCACACC
GGTGCTAGCTATTTGCGATTCCATCAACGCGGCTTTGGCGCAGTCGGTGTGTCCGAGAAATACGGAAAGCGCTCA
TTGGCCCGTTACCCAATCTTCTGGAGTCTCGGCAAGATTGGCAGTCTTCCCAATCCAGATCCCTCCGACACAGCC
GCCCTGAAGAAAGACCCCGATGTGCAAGTTACGGTTCAGTCTGCTGACGAGCACGCCAATGACAAAACCCAGGCA
CAGAAGTGGGCTGGTCTGGACGAGGATCCCAGCGCTGACTTGCTAGTATTTGTCGGAAGATGGTCTAAGCAGAAG
GGAGTCGACTTGATTGCGGATGTTATGCCAGCTGTCCTGTCTGCTAGACCTAATGTCCAGCTGATCTGCATTGGT
CCTATTATTGATCTTTATGGTAAGCTGGCCGCTATCAAGCTCGAGCGCATCGTGGAAATGTTCCCAGGCCGTGTC
TGCTCGAAGCCACAGTTCACAGTCCTCCCCCCCTTCGTGTTCTCTGGTGCCGACTTCGCCCTGATCCCGTCTCGC
GACGAGCCCTTCGGATTGATTGCCGTTGAGTTTGGTCGTAAGGGTGCACTTGGAATTGGTTCTCGCATTGGTGGT
TTAGGCCAGATGCCTGGTTGGTGGTACACTGTGGAATCCGACTCAGCCCGCCATCTCTTGCACCAGTTGAGGACC
GCCATCAAGTCCGCTTTGGACTCAACACCGGAGACCCGAAAAGAGATGCGCGAAAACTCTGCCAAGCAGCGATTC
CCCGTTCTCGAGTGGGTTCAGAAGCTCGAGGTCTTACAGCGGACATCTATTCAGATCCATCACCAAAAGAATCAA
CTCACTGTTGCAGGCACGGCACGAGACACTCAGATCTTCTGGGAGACGCCAGCGTTGCGAGACTCTGCACTGGTC
ACCCGCCCTTCATCATTCCAGTCAGCGACGGCTTTGGATACGCCACCACTTGGCAGAGCACCACAGCCTTTCCAG
CCTTCCCTTCTGCAGCTCCAGGCTGTTGAAGCTCAAGAAATGCAAGTGGCTGAAAGCAACAGAGGTAGCATGCTG
GGTCGAAACCTGTCCCTTGGTCGACGATCTGGACCAGGACATGGCAGAAAGCGTCTCTTCAGGAAGTCGCAGCGT
GGGAGTCAGTTCACCGAGCCCGCCGACGGTGATACCACGGACGCCGACGATGATGGTACTGCCACACCACAGGAG
AAACTCATTTCTCAAGAAGAGGCCATGGCAGCAGTTAATTCACCTATGGAGTTCGGCGCGCACCCCAGACACAGC
AATCAGTCTGGCGAGTCAATCTCGTCGACCTCAGAGTCAATGCGTTTCATGTCGAGGGACCCCTCTCCAGTGAGA
CTGACTAGGGATCTTTCTGATTCGGCTGTACCCTTCGCTCACGCTCCGAATATGTCTGTCCTCTCCTTGCCTTCT
GTTGTTAATGACCATGATCAACCCAATTTCCATCTGCAAAAGGTCGACCCGACCTTTACGGACAGCATGGGCTAC
TTCACGCGGCACTTTGAACAGCAGCTCACCAACCTCAACAAGAAAAACTCAATTTCAGATTATTGTATTGAGCTT
TATCTCATGAAGAGTGAGCGGAAGTTCTTCTACATGTACAGCGATGCGCAGTTGAAGAAGCAGCCCAAAGAGCGA
CCCGTGACTGGAAGTGGCTCGGACAAGACTGACGAGCCTGCCCCGCCGTACAGCCTCGTCACAGAGGGTCACGAA
GAGTCGAATGAGAACAATACAGATGAAATTGATCTGTGGCTCTCTCGTCTGGGATACAAGAGACCCATTGCCATC
CAGCGCTTCATGAGATGGCGTGTCGGAAACTGGCCTGTCTATGCTCTATTCTTGGGTCTCGGACAGATTATCGCC
ACGAACTCTGCGCAGATCACCCTGTTGGCTGGCCAGATTGGTGAGACGGCAGTCAAGCTCTACGTGATCGCGGCA
ATCTACTGTGTCTCTTCCATTGCCTGGTGGTTCCTCTTCTACCGCTTCCCGTCTGTGATAGTCCTCTCTCTCCCC
TGGTTCATCTACTGCATGGCATTCATCACCATTGGCGTTTCTCCGTTCGCTCTCTCGGACCTCGGTCAAGCGTGG
GCTCAGAATGTCGCCGCAGGTACTTATGCCGCAGCATCTTCCAGTGGTTCCTTGTTCTTTGCTCTCAACTTTGGT
GACCAAGGTGCCGTCCCTGTGAAGGATTGGATGTTCCGCGCCAGTATGATCCAAGGAATCTCACAGCTCTACACT
GTTGCCCTGTGGTACTGGAGTTCCAGAGTCACTTCAGCGGAAGTTGGAGGTGTTTCCACGGTTGCCTTGAATTCC
TGGAGACTCTCGGCTGTGGTGATGCCCATTGCCGCGGTTTGTTTCATCATCGGTATGCTCCTTGCCCTTGGCTTG
CCCAAGTACTATCGCCAAGCACCCGGAAAGATCCTCTTCTTCTACACCTCCCTCTTCCGCCGCCGAATCGTCCTC
TGGTTCTTCTTCATGGTCATCGTCCAGAACTGGTTCCTTTCCGCCGCGTTCGGTCGAAACTGGTCATTCCTCTGG
TCCTCTCAGCACACCAAACCATGGTACATTGTCCTCCTGGTCCTGTTTTTCTTTATCATCCTCTGGATCGCTGTG
ATGCTCCTCTTCCGCTTCTTATCCAAGGAGCACAGTTGGATCTTACCCGTCTTCGGCCTGAGTATCGGTGCACCA
CGATGGGCGCAAACATGGTGGGGAACATCCAACATCGGCCACTACCTTCCATGGGCTGGAGGTTTAACTTCCGGC
GCCATCGCATCCCGGTGTGTTTGGCTCTGGCTCGGCGTTCTCGACGAGATCCAACAAGTCGGATTGGGAATGATT
CTCCTGCAGACTCTGACACGAGTACACGTCGTTTTCGTCCTATTGGCCGCGCAATCTCTTGGATCCATCGCCACA
ATTTGTGCTCGTGGATTCGCGCCAAACAAGGTCGGCCCAGCAAGCATCTCCCCCGCTGTTGGATCGTCGCTGGAC
ACAGTTGCCAATGCGTGGTTCTGGATTGCCCTTTTCTTCCAGCTTCTTGCTAGCTTTGGTTTCCTTCTCTTTTAC
CGCCGTGAACAGCTCAATCGGCCATAG
Transcript >Pro_DTO377G3_2|g3408.t1
ATGCAGCGCTCAGCTTTCCTCATACTGTCGTTTTTGAGCGTCTTTGCCTTTGCCTGGCCCTACGATAAACCACTC
GCTAAATACAATCTCAACGAAAACAAATCCGCCGAAAGCCCCATCGATTATTGGGGAGCATGGCCGGACCATGAT
TATCACCCGTCGCCAGATAACTGGCGCATGCCTACATATACAATCTTTTTGGACCGTATAGCCAACGGCGACCCG
ACCAATGACGATATCAACGGGACCGCCTTTGAGCATGTGGTCAACTCCAATCAGATGCGCCATGGAGGTGATTTG
GAGGGGTTGATAGATACGTTGGACTACATCCAGGGAATGGGATTCAAGGTCATCTACTTCGCCGGAACGTACTTG
ATGAACTTGCCCTGGGCCTACGATGGGTACTCGCCGGTCGATACCACCCTCCTTGACATGCATTATGGAACACTG
GATGACTGGAGGCGGACCGTGGAGGAGATTCACAAACGGGAGATGTATGTGTTGGTGGATAACACACTGGCAACA
ATGAGCAACCTCATCGGATTCAAAGGCCATCTGAACGATTCCGCCGATTTCAAAGCATCTGAATATGAAGTCCAA
TGGGTCACCGACCGAGAATATGCCGATTTCAACTTCGGTAACGACTATAACGAATCTTGCAGCTATCCCAAGTTC
TGGGATGAGACTGGATATCCATTAACCACCTCGGGCGTCCAAAATTTGAAGGGTTGCTATAACAGCGATTTCGAT
CAATACGGAGAGCTTGAGGCATTCGGTAATTTCCCCGACTGGCAGCGTCAACTTACCAAGTTCGCCTCCGTGCAG
GATCGTCTACGTGAATGGCACAAGCCGGTCCGCGATGTGATCACTCAACATTCCTGCCTCCAAATCGCGAGTCTA
GACATCGACGGTTTCCGCTTCGATAAGTCTGTGCAATCGACCCTCGAGCCCCTGAGTGAGATGATGGCCGTCTAC
CGTGAATGCGCGCAGGCACTCGGCAAGAAAAATTTCTTCCTCCCCGGCGAGATCACATCTGGAGACAGCTTTGGC
AGTCTCTACCTCGGCCGCGGCCGCCAACCAAACCAGCGTACAGCCAACGCAGGCGCGGGTATCAAGATCACGAAC
AGCTCGGATGGGGCGTTCCTGAGAGACGATGGGCTGCAAGCTTTGGATGCCTCCGCATTTCACTATACCATTTAC
CGTTCGATGACCCGTTTCCTAGGCATGGACGGTAACCTGGTTGCTGGCTTTGATTTGCCTACCGATTTCATCGAA
GCCTGGAATGAGATGCTCATCACTAACGATTTCCTCAATGCATTCACAGGAGAAGTTGATCCGAGACATATGTAT
GGTGTCTCGAACCAGGATAATTTCCGCTGGCCAGCTCTCCAAAATGGCACAGATAAATACCTCCTGGGTTTGTAC
ATCATCACATTGGAGCTGCCTGGAATCCCTCTCATCTTGTGGGGAGAAGAGCAGGAGATGTACGTGTTTGACGCT
ACCGCAGCGAACTATATGTTCGGTCGGCAACCCATGACGTACCAAACCGCGTGGTGGACACAAGGCTGCTTCAAC
TTGAACACCTCAAAGTTCTACGATTTCCCCATCGAAAAGGGTCGCGATGGCTGCAATGATATCACTGTCACGTAC
GACCAGCGGAATCCCGCCCATCCACTGCGTAACATCATGAAGCGCATGTTCGAGATCCGTGCGCATTACCCGGTC
GCCATGGATGGCTTGTACCTCGAAACACTCTCCGAACTGACACAAGACATCTACCTCCCTGGTTCTTCTACCACC
CCCACGGTCACTGGCCTTTGGTCTGTCCTGCGAAGCTATTTCCCTGCGGTACAAACAGACGCGATCCTGGCCAAC
GAAACTCTATGGCTTGTGTATCAGAATGGAAACTCAACCGTCACATACGGGGGCAACTGCAGCGATAAGAATACG
TCCTTATTGGCTCCATTCGACTCAGGGACAAAATTGAAGAACCTCTTTTATCCTTACGATGAGCTCACCTTGCAG
GATGGCCCCGCCAAGGCAGACAACGTCAACCTCTATGGATGCGTCAGGAAAATGGAGCTGCTTCCATGGGAATAC
CGGGCCTATGTCAAGAGCTCCAACTTCGTCGAACCCGGCCCTACCGTCACCGATTTCTATCCCGGACATGATACT
CGGTTGCTATCTTCAGAAGACACGGGCGAAACCCTGCCCATTCAGCTTGGATATTCCAAGGCAATGGACTGTAGC
AGCATCACAGAAGCCATTTACCTAAATTCTACAACAGAGAAAAACATCACCGCCGTGCTTGATACGGATAGTGTC
AAGTGCGCCAATATCTCTGCCAGGACCACCAGCCATAACTTCACCGGCGAAATCCCGACTGTTTGGACATGGTCT
GCAAACCTGAAGAACGTCCACCACGGAATCCACCAACTAACTGTCCAAAATGTTTCCACTTCCGGAGTTTACACC
AATGCGACCGACAAATTCTTGATCCGCCTAGGCGCTTCTGACAATCCCCTGATTTCTCCGCTTGCCAATTACTCT
ACCAGCCTAGTGCAAAAGTCCAACGATGACCTTTACATCCAGCACAGAGCTGCCGGTGCGGACATGTTCCGATAT
ACGGCTGATTTCGGCCTGAGCTGGACCGATTGGACGACTTATTCAGGTGGCAACACGACTATTACCATCCCAGCC
TTCACAGGTACGGACGCCCAGAAGTGGGAGGGAACTCATATCCGGGTGCAGTACTTTTCGAGGCTCACTGGAAGC
AGCGATTACCTCCAGGAAGGTGATTATGCGAGCACCACAGTCCGAAGATTCCCGCACATTTGGTTCAACGGCCCA
TATAACCAATATGGCTATGATGCAGGAATGGACAGCAAGATGAAGTTCGATTCCAAAACGTCTCGTTGGATCTAC
GACTTCGTCTACGAATGGCCAGCTGTGGGTCAGCTGAACGTTTGGGGCCAGGACAAGGAGGGCACTCCTGATAAT
ACCGAGGTCTACGGTGACGTCGGCAACTCGTCTTCAGTTCAAAAGCTTCCACCGTCCTACCTCGCATCCAACGTC
ATCAACATCACCATTCTGCCACCGTTCCCGCATCTTGGCTGGACCATCTCCCTCAACGATGGCAACCTAAGGTAC
GAACTGATTCCCGTTGGATCTGGATGGGCCCAGTTGGTCCTCTTTATTCTTTTCTGGGTTATTCCGCTTGTTATG
GGCTGCGCCGGTGTTTTCATCTTCATCGGAAACTTCTACCGGGTCAAACTCAACCTGAATGGCAATGCCATCAAG
ACCGAGAAGTTCCCGGTGGTGCTTTGGCGCAGAATGAAGGGAACGTTTTCCAAAGATAATGTCGAGGAGATCAAT
ATGGCAGAAAAGGCCCCGCCAACAATCATGGGAATGGCAGGCGCGAGCGATCAACGACGCACTGTATTGATTGCC
ACTATGGAGTATGACATTCAAGACTGGAAGATCAAAGTCAAGATTGGTGGCCTGGGAGTGATGGCGCAGCTCATG
TCCCAAAATCTGAAGCACCAGAATCTCATCTGGGTGGTCCCGTGTGTCGGCGATATTGACTACCCTGAGGATACG
CCTGTTGAACCTTTCGTGGTGACGATCCTAGATCATCCCTACTCAGTCAAGGTCCAGTATCACGTTGTCGATAAC
ATCACCTATGTTCTACTCGATGCTCCGGTTTTCCGCCAGCAGACCAAGGCCGAGCCATACCCTCCACGTATGGAT
GACCTTGACAGTGCAATTTACTATTCGGCCTGGAATCAATGTATTGCAGAGGTAATGCGGCGAACACCCTCGATT
GATCTCTATCACATCAACGACTTCCACGGCTGCGTGGCACCGCTTTACCTGCTCCCGTCGCGAACTATTCCAGTC
TGTTTGTCTCTGCACAATGCCGAGTTCCAAGGTCTTTGGGCTCTGAGGACCGCACAAGAGAAGAAAGAAGTCTGT
GCTGTGTTCAATCTCCCAGTAGAAGTGGCCACAAAATACTGTCAGTTTGGCAGCGTTTTCAACCTGCTTCACACC
GGTGCTAGCTATTTGCGATTCCATCAACGCGGCTTTGGCGCAGTCGGTGTGTCCGAGAAATACGGAAAGCGCTCA
TTGGCCCGTTACCCAATCTTCTGGAGTCTCGGCAAGATTGGCAGTCTTCCCAATCCAGATCCCTCCGACACAGCC
GCCCTGAAGAAAGACCCCGATGTGCAAGTTACGGTTCAGTCTGCTGACGAGCACGCCAATGACAAAACCCAGGCA
CAGAAGTGGGCTGGTCTGGACGAGGATCCCAGCGCTGACTTGCTAGTATTTGTCGGAAGATGGTCTAAGCAGAAG
GGAGTCGACTTGATTGCGGATGTTATGCCAGCTGTCCTGTCTGCTAGACCTAATGTCCAGCTGATCTGCATTGGT
CCTATTATTGATCTTTATGGTAAGCTGGCCGCTATCAAGCTCGAGCGCATCGTGGAAATGTTCCCAGGCCGTGTC
TGCTCGAAGCCACAGTTCACAGTCCTCCCCCCCTTCGTGTTCTCTGGTGCCGACTTCGCCCTGATCCCGTCTCGC
GACGAGCCCTTCGGATTGATTGCCGTTGAGTTTGGTCGTAAGGGTGCACTTGGAATTGGTTCTCGCATTGGTGGT
TTAGGCCAGATGCCTGGTTGGTGGTACACTGTGGAATCCGACTCAGCCCGCCATCTCTTGCACCAGTTGAGGACC
GCCATCAAGTCCGCTTTGGACTCAACACCGGAGACCCGAAAAGAGATGCGCGAAAACTCTGCCAAGCAGCGATTC
CCCGTTCTCGAGTGGGTTCAGAAGCTCGAGGTCTTACAGCGGACATCTATTCAGATCCATCACCAAAAGAATCAA
CTCACTGTTGCAGGCACGGCACGAGACACTCAGATCTTCTGGGAGACGCCAGCGTTGCGAGACTCTGCACTGGTC
ACCCGCCCTTCATCATTCCAGTCAGCGACGGCTTTGGATACGCCACCACTTGGCAGAGCACCACAGCCTTTCCAG
CCTTCCCTTCTGCAGCTCCAGGCTGTTGAAGCTCAAGAAATGCAAGTGGCTGAAAGCAACAGAGGTAGCATGCTG
GGTCGAAACCTGTCCCTTGGTCGACGATCTGGACCAGGACATGGCAGAAAGCGTCTCTTCAGGAAGTCGCAGCGT
GGGAGTCAGTTCACCGAGCCCGCCGACGGTGATACCACGGACGCCGACGATGATGGTACTGCCACACCACAGGAG
AAACTCATTTCTCAAGAAGAGGCCATGGCAGCAGTTAATTCACCTATGGAGTTCGGCGCGCACCCCAGACACAGC
AATCAGTCTGGCGAGTCAATCTCGTCGACCTCAGAGTCAATGCGTTTCATGTCGAGGGACCCCTCTCCAGTGAGA
CTGACTAGGGATCTTTCTGATTCGGCTGTACCCTTCGCTCACGCTCCGAATATGTCTGTCCTCTCCTTGCCTTCT
GTTGTTAATGACCATGATCAACCCAATTTCCATCTGCAAAAGGTCGACCCGACCTTTACGGACAGCATGGGCTAC
TTCACGCGGCACTTTGAACAGCAGCTCACCAACCTCAACAAGAAAAACTCAATTTCAGATTATTGTATTGAGCTT
TATCTCATGAAGAGTGAGCGGAAGTTCTTCTACATGTACAGCGATGCGCAGTTGAAGAAGCAGCCCAAAGAGCGA
CCCGTGACTGGAAGTGGCTCGGACAAGACTGACGAGCCTGCCCCGCCGTACAGCCTCGTCACAGAGGGTCACGAA
GAGTCGAATGAGAACAATACAGATGAAATTGATCTGTGGCTCTCTCGTCTGGGATACAAGAGACCCATTGCCATC
CAGCGCTTCATGAGATGGCGTGTCGGAAACTGGCCTGTCTATGCTCTATTCTTGGGTCTCGGACAGATTATCGCC
ACGAACTCTGCGCAGATCACCCTGTTGGCTGGCCAGATTGGTGAGACGGCAGTCAAGCTCTACGTGATCGCGGCA
ATCTACTGTGTCTCTTCCATTGCCTGGTGGTTCCTCTTCTACCGCTTCCCGTCTGTGATAGTCCTCTCTCTCCCC
TGGTTCATCTACTGCATGGCATTCATCACCATTGGCGTTTCTCCGTTCGCTCTCTCGGACCTCGGTCAAGCGTGG
GCTCAGAATGTCGCCGCAGGTACTTATGCCGCAGCATCTTCCAGTGGTTCCTTGTTCTTTGCTCTCAACTTTGGT
GACCAAGGTGCCGTCCCTGTGAAGGATTGGATGTTCCGCGCCAGTATGATCCAAGGAATCTCACAGCTCTACACT
GTTGCCCTGTGGTACTGGAGTTCCAGAGTCACTTCAGCGGAAGTTGGAGGTGTTTCCACGGTTGCCTTGAATTCC
TGGAGACTCTCGGCTGTGGTGATGCCCATTGCCGCGGTTTGTTTCATCATCGGTATGCTCCTTGCCCTTGGCTTG
CCCAAGTACTATCGCCAAGCACCCGGAAAGATCCTCTTCTTCTACACCTCCCTCTTCCGCCGCCGAATCGTCCTC
TGGTTCTTCTTCATGGTCATCGTCCAGAACTGGTTCCTTTCCGCCGCGTTCGGTCGAAACTGGTCATTCCTCTGG
TCCTCTCAGCACACCAAACCATGGTACATTGTCCTCCTGGTCCTGTTTTTCTTTATCATCCTCTGGATCGCTGTG
ATGCTCCTCTTCCGCTTCTTATCCAAGGAGCACAGTTGGATCTTACCCGTCTTCGGCCTGAGTATCGGTGCACCA
CGATGGGCGCAAACATGGTGGGGAACATCCAACATCGGCCACTACCTTCCATGGGCTGGAGGTTTAACTTCCGGC
GCCATCGCATCCCGGTGTGTTTGGCTCTGGCTCGGCGTTCTCGACGAGATCCAACAAGTCGGATTGGGAATGATT
CTCCTGCAGACTCTGACACGAGTACACGTCGTTTTCGTCCTATTGGCCGCGCAATCTCTTGGATCCATCGCCACA
ATTTGTGCTCGTGGATTCGCGCCAAACAAGGTCGGCCCAGCAAGCATCTCCCCCGCTGTTGGATCGTCGCTGGAC
ACAGTTGCCAATGCGTGGTTCTGGATTGCCCTTTTCTTCCAGCTTCTTGCTAGCTTTGGTTTCCTTCTCTTTTAC
CGCCGTGAACAGCTCAATCGGCCATAG
Gene >Pro_DTO377G3_2|g3408.t1
ATGCAGCGCTCAGCTTTCCTCATACTGTCGTTTTTGAGCGTCTTTGCCTTTGCCTGGCCCTACGATAAACCACTC
GCTAAATACAATCTCAACGAAAACAAATCCGCCGAAAGCCCCATCGATTATTGGGGAGCATGGCCGGACCATGAT
TATCACCCGTCGCCAGATAACTGGCGCATGCCTACATATACAATCTTTTTGGACCGTATAGCCAACGGCGACCCG
ACCAATGACGATATCAACGGGACCGCCTTTGAGCATGTGGTCAACTCCAATCAGATGCGCCATGGAGGTGATTTG
GAGGGGTTGATAGATACGTTGGACTACATCCAGGGAATGGGATTCAAGGTTAGTGGACCCGGCCTCCTAATGCTT
CCATCTCTAACACCGACAAGGTCATCTACTTCGCCGGAACGTACTTGATGAACTTGCCCTGGGCCTACGATGGGT
ACTCGCCGGTCGATACCACCCTCCTTGACATGCATTATGGAACACTGGATGACTGGAGGCGGACCGTGGAGGAGA
TTCACAAACGGGAGATGTATGTGTTGGTGGATAACACACTGGCAACGTAAGTCATGCTCTGATCTTCGCGCATCT
TGGGATGTTCATGAGCTGATCAAAACACAGAATGAGCAACCTCATCGGATTCAAAGGCCATCTGAACGATTCCGC
CGATTTCAAAGCATCTGAATATGAAGTCCAATGGGTCACCGACCGAGAATATGCCGATTTCAACTTCGGTAACGA
CTATAACGAATCTTGCAGCTATCCCAAGTTCTGGGATGAGACTGGATATCCATTAACCACCTCGGGCGTCCAAAA
TTTGAAGGGTTGCTATAACAGCGATTTCGATCAATACGGAGAGCTTGAGGCATTCGGTAATTTCCCCGACTGGCA
GCGTCAACTTACCAAGTTCGCCTCCGTGCAGGATCGTCTACGTGAATGGCACAAGCCGGTCCGCGATGTGATCAC
TCAACATTCCTGCCTCCAAATCGCGAGTCTAGACATCGACGGTTTCCGCTTCGATAAGTCTGTGCAATCGACCCT
CGAGCCCCTGAGTGAGATGATGGCCGTCTACCGTGAATGCGCGCAGGCACTCGGCAAGAAAAATTTCTTCCTCCC
CGGCGAGATCACATCTGGAGACAGCTTTGGCAGTCTCTACCTCGGCCGCGGCCGCCAACCAAACCAGCGTACAGC
CAACGCAGGCGCGGGTATCAAGATCACGAACAGCTCGGATGGGGCGTTCCTGAGAGACGATGGGCTGCAAGCTTT
GGATGCCTCCGCATTTCACTATACCATTTACCGTTCGATGACCCGTTTCCTAGGCATGGACGGTAACCTGGTTGC
TGGCTTTGATTTGCCTACCGATTTCATCGAAGCCTGGAATGAGATGCTCATCACTAACGATTTCCTCAATGCATT
CACAGGAGAAGTTGATCCGAGACATATGTATGGTGTCTCGAACCAGGATAATTTCCGCTGGCCAGCTCTCCAAAA
TGGCACAGATAAATACCTCCTGGGTTTGTACATCATCACATTGGAGCTGCCTGGAATCCCTCTCATCTTGTGGGG
AGAAGAGCAGGAGATGTACGTGTTTGACGCTACCGCAGCGAACTATATGTTCGGTCGGCAACCCATGACGTACCA
AACCGCGTGGTGGACACAAGGCTGCTTCAACTTGAACACCTCAAAGTTCTACGATTTCCCCATCGAAAAGGGTCG
CGATGGCTGCAATGATATCACTGTCACGTACGACCAGCGGAATCCCGCCCATCCACTGCGTAACATCATGAAGCG
CATGTTCGAGATCCGTGCGCATTACCCGGTCGCCATGGATGGCTTGTACCTCGAAACACTCTCCGAACTGACACA
AGACATCTACCTCCCTGGTTCTTCTACCACCCCCACGGTCACTGGCCTTTGGTCTGTCCTGCGAAGCTATTTCCC
TGCGGTACAAACAGACGCGATCCTGGCCAACGAAACTCTATGGCTTGTGTATCAGAATGGAAACTCAACCGTCAC
ATACGGGGGCAACTGCAGCGATAAGAATACGTCCTTATTGGCTCCATTCGACTCAGGGACAAAATTGAAGAACCT
CTTTTATCCTTACGATGAGCTCACCTTGCAGGATGGCCCCGCCAAGGCAGACAACGTCAACCTCTATGGATGCGT
CAGGAAAATGGAGCTGCTTCCATGGGAATACCGGGCCTATGTCAAGAGCTCCAACTTCGTCGAACCCGGCCCTAC
CGTCACCGATTTCTATCCCGGACATGATACTCGGTTGCTATCTTCAGAAGACACGGGCGAAACCCTGCCCATTCA
GCTTGGATATTCCAAGGCAATGGACTGTAGCAGCATCACAGAAGCCATTTACCTAAATTCTACAACAGAGAAAAA
CATCACCGCCGTGCTTGATACGGATAGTGTCAAGTGCGCCAATATCTCTGCCAGGACCACCAGCCATAACTTCAC
CGGCGAAATCCCGACTGTTTGGACATGGTCTGCAAACCTGAAGAACGTCCACCACGGAATCCACCAACTAACTGT
CCAAAATGTTTCCACTTCCGGAGTTTACACCAATGCGACCGACAAATTCTTGATCCGCCTAGGCGCTTCTGACAA
TCCCCTGATTTCTCCGCTTGCCAATTACTCTACCAGCCTAGTGCAAAAGTCCAACGATGACCTTTACATCCAGCA
CAGAGCTGCCGGTGCGGACATGTTCCGATATACGGCTGATTTCGGCCTGAGCTGGACCGATTGGACGACTTATTC
AGGTGGCAACACGACTATTACCATCCCAGCCTTCACAGGTACGGACGCCCAGAAGTGGGAGGGAACTCATATCCG
GGTGCAGTACTTTTCGAGGCTCACTGGAAGCAGCGATTACCTCCAGGAAGGTGATTATGCGAGCACCACAGTCCG
AAGATTCCCGCACATTTGGTTCAACGGCCCATATAACCAATATGGCTATGATGCAGGAATGGACAGCAAGATGAA
GTTCGATTCCAAAACGTCTCGTTGGATCTACGACTTCGTCTACGAATGGCCAGCTGTGGGTCAGCTGAACGTTTG
GGGCCAGGACAAGGAGGGCACTCCTGATAATACCGAGGTCTACGGTGACGTCGGCAACTCGTCTTCAGTTCAAAA
GCTTCCACCGTCCTACCTCGCATCCAACGTCATCAACATCACCATTCTGCCACCGTTCCCGCATCTTGGCTGGAC
CATCTCCCTCAACGATGGCAACCTAAGGTACGAACTGATTCCCGTTGGATCTGGATGGGCCCAGTTGGTCCTCTT
TATTCTTTTCTGGGTTATTCCGCTTGTTATGGGCTGCGCCGGTGTTTTCATCTTCATCGGAAACTTCTACCGGGT
CAAACTCAACCTGAATGGCAATGCCATCAAGACCGAGAAGTTCCCGGTGGTGCTTTGGCGCAGAATGAAGGGAAC
GTTTTCCAAAGATAATGTCGAGGAGATCAATATGGCAGAAAAGGCCCCGCCAACAATCATGGGAATGGCAGGCGC
GAGCGATCAACGACGCACTGTATTGATTGCCACTATGGAGTATGACATTCAAGACTGGAAGATCAAAGTCAAGAT
TGGTGGCCTGGGAGTGATGGCGCAGCTCATGTCCCAAAATCTGAAGCACCAGAATCTCATCTGGGTGGTCCCGTG
TGTCGGCGATATTGACTACCCTGAGGATACGCCTGTTGAACCTTTCGTGGTGACGATCCTAGATCATCCCTACTC
AGTCAAGGTCCAGTATCACGTTGTCGATAACATCACCTATGTTCTACTCGATGCTCCGGTTTTCCGCCAGCAGAC
CAAGGCCGAGCCATACCCTCCACGTATGGATGACCTTGACAGTGCAATTTACTATTCGGCCTGGAATCAATGTAT
TGCAGAGGTAATGCGGCGAACACCCTCGATTGATCTCTATCACATCAACGACTTCCACGGCTGCGTGGCACCGCT
TTACCTGCTCCCGTCGCGAACTATTCCAGTCTGTTTGTCTCTGCACAATGCCGAGTTCCAAGGTCTTTGGGCTCT
GAGGACCGCACAAGAGAAGAAAGAAGTCTGTGCTGTGTTCAATCTCCCAGTAGAAGTGGCCACAAAATACTGTCA
GTTTGGCAGCGTTTTCAACCTGCTTCACACCGGTGCTAGCTATTTGCGATTCCATCAACGCGGCTTTGGCGCAGT
CGGTGTGTCCGAGAAATACGGAAAGCGCTCATTGGCCCGTTACCCAATCTTCTGGAGTCTCGGCAAGATTGGCAG
TCTTCCCAATCCAGATCCCTCCGACACAGCCGCCCTGAAGAAAGACCCCGATGTGCAAGTTACGGTTCAGTCTGC
TGACGAGCACGCCAATGACAAAACCCAGGCACAGAAGTGGGCTGGTCTGGACGAGGATCCCAGCGCTGACTTGCT
AGTATTTGTCGGAAGATGGTCTAAGCAGAAGGGAGTCGACTTGATTGCGGATGTTATGCCAGCTGTCCTGTCTGC
TAGACCTAATGTCCAGCTGATCTGCATTGGTCCTATTATTGATCTTTATGGTAAGCTGGCCGCTATCAAGCTCGA
GCGCATCGTGGAAATGTTCCCAGGCCGTGTCTGCTCGAAGCCACAGTTCACAGTCCTCCCCCCCTTCGTGTTCTC
TGGTGCCGACTTCGCCCTGATCCCGTCTCGCGACGAGCCCTTCGGATTGATTGCCGTTGAGTTTGGTCGTAAGGG
TGCACTTGGAATTGGTTCTCGCATTGGTGGTTTAGGCCAGATGCCTGGTTGGTGGTACACTGTGGAATCCGACTC
AGCCCGCCATCTCTTGCACCAGTTGAGGACCGCCATCAAGTCCGCTTTGGACTCAACACCGGAGACCCGAAAAGA
GATGCGCGAAAACTCTGCCAAGCAGCGATTCCCCGTTCTCGAGTGGGTTCAGAAGCTCGAGGTCTTACAGCGGAC
ATCTATTCAGATCCATCACCAAAAGAATCAACTCACTGTTGCAGGCACGGCACGAGACACTCAGATCTTCTGGGA
GACGCCAGCGTTGCGAGACTCTGCACTGGTCACCCGCCCTTCATCATTCCAGTCAGCGACGGCTTTGGATACGCC
ACCACTTGGCAGAGCACCACAGCCTTTCCAGCCTTCCCTTCTGCAGCTCCAGGCTGTTGAAGCTCAAGAAATGCA
AGTGGCTGAAAGCAACAGAGGTAGCATGCTGGGTCGAAACCTGTCCCTTGGTCGACGATCTGGACCAGGACATGG
CAGAAAGCGTCTCTTCAGGAAGTCGCAGCGTGGGAGTCAGTTCACCGAGCCCGCCGACGGTGATACCACGGACGC
CGACGATGATGGTACTGCCACACCACAGGAGAAACTCATTTCTCAAGAAGAGGCCATGGCAGCAGTTAATTCACC
TATGGAGTTCGGCGCGCACCCCAGACACAGCAATCAGTCTGGCGAGTCAATCTCGTCGACCTCAGAGTCAATGCG
TTTCATGTCGAGGGACCCCTCTCCAGTGAGACTGACTAGGGATCTTTCTGATTCGGCTGTACCCTTCGCTCACGC
TCCGAATATGTCTGTCCTCTCCTTGCCTTCTGTTGTTAATGACCATGATCAACCCAATTTCCATCTGCAAAAGGT
CGACCCGACCTTTACGGACAGCATGGGCTACTTCACGCGGCACTTTGAACAGCAGCTCACCAACCTCAACAAGAA
AAACTCAATTTCAGATTATTGTATTGAGCTTTATCTCATGAAGAGTGAGCGGAAGTTCTTCTACATGTACAGCGA
TGCGCAGTTGAAGAAGCAGCCCAAAGAGCGACCCGTGACTGGAAGTGGCTCGGACAAGACTGACGAGCCTGCCCC
GCCGTACAGCCTCGTCACAGAGGGTCACGAAGAGTCGAATGAGAACAATACAGATGAAATTGATCTGTGGCTCTC
TCGTCTGGGATACAAGAGACCCATTGCCATCCAGCGCTTCATGAGATGGCGTGTCGGAAACTGGCCTGTCTATGC
TCTATTCTTGGGTCTCGGACAGATTATCGCCACGAACTCTGCGCAGATCACCCTGTTGGCTGGCCAGATTGGTGA
GACGGCAGTCAAGCTCTACGTGATCGCGGCAATCTACTGTGTCTCTTCCATTGCCTGGTGGTTCCTCTTCTACCG
CTTCCCGTCTGTGATAGTCCTCTCTCTCCCCTGGTTCATCTACTGCATGGCATTCATCACCATTGGCGTTTCTCC
GTTCGCTCTCTCGGACCTCGGTCAAGCGTGGGCTCAGAATGTCGCCGCAGGTACTTATGCCGCAGCATCTTCCAG
TGGTTCCTTGTTCTTTGCTCTCAACTTTGGTGACCAAGGTGCCGTCCCTGTGAAGGATTGGATGTTCCGCGCCAG
TATGATCCAAGGAATCTCACAGCTCTACACTGTTGCCCTGTGGTACTGGAGTTCCAGAGTCACTTCAGCGGAAGT
TGGAGGTGTTTCCACGGTTGCCTTGAATTCCTGGAGACTCTCGGCTGTGGTGATGCCCATTGCCGCGGTTTGTTT
CATCATCGGTATGCTCCTTGCCCTTGGCTTGCCCAAGTACTATCGCCAAGCACCCGGAAAGATCCTCTTCTTCTA
CACCTCCCTCTTCCGCCGCCGAATCGTCCTCTGGTTCTTCTTCATGGTCATCGTCCAGAACTGGTTCCTTTCCGC
CGCGTTCGGTCGAAACTGGTCATTCCTCTGGTCCTCTCAGCACACCAAACCATGGTACATTGTCCTCCTGGTCCT
GTTTTTCTTTATCATCCTCTGGATCGCTGTGATGCTCCTCTTCCGCTTCTTATCCAAGGAGCACAGTTGGATCTT
ACCCGTCTTCGGCCTGAGTATCGGTGCACCACGATGGGCGCAAACATGGTGGGGAACATCCAACATCGGCCACTA
CCTTCCATGGGCTGGAGGTTTAACTTCCGGCGCCATCGCATCCCGGTGTGTTTGGCTCTGGCTCGGCGTTCTCGA
CGAGATCCAACAAGTCGGATTGGGAATGATTCTCCTGCAGACTCTGACACGAGTACACGTCGTTTTCGTCCTATT
GGCCGCGCAATCTCTTGGATCCATCGCCACAATTTGTGCTCGTGGATTCGCGCCAAACAAGGTCGGCCCAGCAAG
CATCTCCCCCGCTGTTGGATCGTCGCTGGACACAGTTGCCAATGCGTGGTTCTGGATTGCCCTTTTCTTCCAGCT
TCTTGCTAGGTTAGTGATCCCCCCCTTTTCCCTTACTTATATTATGGCGTTGTACTGACTGTGATTTTAGCTTTG
GTTTCCTTCTCTTTTACCGCCGTGAACAGCTCAATCGGCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail