Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3394.t1
Gene name
Locationscaffold_05:558600..559995
Strand-
Gene length (bp)1395
Transcript length (bp)1278
Coding sequence length (bp)1278
Protein length (aa) 426

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00762 Ferrochelatase Ferrochelatase 2.7E-99 55 385

GO

GO Term Description Terminal node
GO:0004325 ferrochelatase activity Yes
GO:0006783 heme biosynthetic process Yes
GO:0046483 heterocycle metabolic process No
GO:0003824 catalytic activity No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006778 porphyrin-containing compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0006779 porphyrin-containing compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0042440 pigment metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0033014 tetrapyrrole biosynthetic process No
GO:0046148 pigment biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0042168 heme metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0033013 tetrapyrrole metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0016829 lyase activity No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3394.t1
MAFRSLFAIPRQLLTETTSLGGRSAFSSQLRCNQRGLATVVPPVTQNATGSKGPTAIVFMNMGGPSTTDEVEDFL
SRLFADGDLIPLGRLQSYIGPLIARRRTSKIQKQYASIGGGSPIRKWSEYQCAEMCKLLDKISPETAPHKPYVAF
RYAAPLTETMYKQLFADGFGNGKGGRAVAFTQYPQYSCSTTGSSLNELWKWRNRLEGKRPNGGSEPAGAIQWSVI
DRWPSHSGLVEAFAQNIEAQLKTYPEEKRDQVVLLFSAHSLPMSVVNRGDTYPAEVAATVHAVMQRLKFKNPYRL
CWQSQVGPSAWLGAQTADTVQEYVKRGQTDLILIPIAFTSDHIETLFELDQEVIHDANNPGVKRAESLNGNPVFI
QALADIARDHLQKGELCSTQMTLRCQGCTSERCLGQKKFFAGQEHASMVV*
Coding >Pro_DTO377G3_2|g3394.t1
ATGGCATTCCGCAGCCTTTTCGCGATCCCCCGACAGTTATTGACTGAGACCACATCTCTCGGAGGTCGGTCGGCA
TTTAGCAGTCAGCTCAGATGCAATCAACGAGGTCTCGCAACGGTGGTACCGCCAGTCACACAAAATGCGACAGGT
TCCAAGGGCCCGACAGCTATTGTTTTTATGAACATGGGTGGACCTTCTACAACGGACGAGGTGGAGGACTTTTTG
AGCAGACTATTTGCTGACGGTGATTTGATTCCCCTGGGACGACTCCAATCGTATATCGGCCCCCTCATCGCACGT
CGGAGAACCTCGAAGATTCAAAAGCAGTACGCAAGTATCGGCGGCGGATCGCCCATTCGGAAATGGTCCGAGTAT
CAATGCGCAGAAATGTGCAAGTTATTGGATAAGATCTCCCCGGAGACCGCGCCGCATAAACCTTATGTCGCCTTC
CGCTACGCTGCCCCATTGACCGAGACCATGTATAAGCAGCTTTTCGCCGATGGGTTTGGCAATGGCAAGGGAGGA
CGTGCTGTCGCGTTTACACAGTACCCGCAGTACTCCTGCTCAACGACCGGCAGTTCCCTTAACGAGCTGTGGAAG
TGGCGTAATCGTCTCGAGGGAAAGCGCCCTAATGGAGGGTCCGAGCCAGCTGGCGCAATCCAGTGGAGTGTCATT
GACCGTTGGCCTTCTCACTCTGGTCTTGTGGAGGCGTTCGCACAAAATATCGAGGCTCAACTCAAGACATACCCA
GAGGAGAAGCGAGACCAGGTCGTGTTGCTGTTCTCGGCCCACAGCTTGCCTATGAGCGTTGTCAACCGAGGTGAT
ACCTACCCGGCCGAAGTTGCAGCGACAGTTCATGCCGTTATGCAACGACTCAAGTTCAAGAACCCATACCGCCTG
TGCTGGCAATCACAGGTCGGACCTAGTGCGTGGCTCGGGGCTCAGACAGCTGATACCGTTCAAGAGTATGTGAAA
CGAGGACAGACGGACTTGATCCTGATTCCCATTGCGTTTACAAGCGACCACATCGAGACACTGTTTGAGCTGGAT
CAGGAAGTCATCCATGATGCCAACAACCCGGGTGTCAAGCGCGCGGAGAGCTTGAATGGAAACCCGGTTTTCATC
CAGGCACTTGCCGATATTGCCCGCGACCACTTGCAAAAGGGAGAATTGTGTTCTACCCAGATGACACTGCGTTGC
CAGGGCTGCACCAGCGAGCGGTGCTTGGGTCAGAAGAAATTCTTTGCCGGCCAGGAACATGCTTCTATGGTGGTC
TAA
Transcript >Pro_DTO377G3_2|g3394.t1
ATGGCATTCCGCAGCCTTTTCGCGATCCCCCGACAGTTATTGACTGAGACCACATCTCTCGGAGGTCGGTCGGCA
TTTAGCAGTCAGCTCAGATGCAATCAACGAGGTCTCGCAACGGTGGTACCGCCAGTCACACAAAATGCGACAGGT
TCCAAGGGCCCGACAGCTATTGTTTTTATGAACATGGGTGGACCTTCTACAACGGACGAGGTGGAGGACTTTTTG
AGCAGACTATTTGCTGACGGTGATTTGATTCCCCTGGGACGACTCCAATCGTATATCGGCCCCCTCATCGCACGT
CGGAGAACCTCGAAGATTCAAAAGCAGTACGCAAGTATCGGCGGCGGATCGCCCATTCGGAAATGGTCCGAGTAT
CAATGCGCAGAAATGTGCAAGTTATTGGATAAGATCTCCCCGGAGACCGCGCCGCATAAACCTTATGTCGCCTTC
CGCTACGCTGCCCCATTGACCGAGACCATGTATAAGCAGCTTTTCGCCGATGGGTTTGGCAATGGCAAGGGAGGA
CGTGCTGTCGCGTTTACACAGTACCCGCAGTACTCCTGCTCAACGACCGGCAGTTCCCTTAACGAGCTGTGGAAG
TGGCGTAATCGTCTCGAGGGAAAGCGCCCTAATGGAGGGTCCGAGCCAGCTGGCGCAATCCAGTGGAGTGTCATT
GACCGTTGGCCTTCTCACTCTGGTCTTGTGGAGGCGTTCGCACAAAATATCGAGGCTCAACTCAAGACATACCCA
GAGGAGAAGCGAGACCAGGTCGTGTTGCTGTTCTCGGCCCACAGCTTGCCTATGAGCGTTGTCAACCGAGGTGAT
ACCTACCCGGCCGAAGTTGCAGCGACAGTTCATGCCGTTATGCAACGACTCAAGTTCAAGAACCCATACCGCCTG
TGCTGGCAATCACAGGTCGGACCTAGTGCGTGGCTCGGGGCTCAGACAGCTGATACCGTTCAAGAGTATGTGAAA
CGAGGACAGACGGACTTGATCCTGATTCCCATTGCGTTTACAAGCGACCACATCGAGACACTGTTTGAGCTGGAT
CAGGAAGTCATCCATGATGCCAACAACCCGGGTGTCAAGCGCGCGGAGAGCTTGAATGGAAACCCGGTTTTCATC
CAGGCACTTGCCGATATTGCCCGCGACCACTTGCAAAAGGGAGAATTGTGTTCTACCCAGATGACACTGCGTTGC
CAGGGCTGCACCAGCGAGCGGTGCTTGGGTCAGAAGAAATTCTTTGCCGGCCAGGAACATGCTTCTATGGTGGTC
TAA
Gene >Pro_DTO377G3_2|g3394.t1
ATGGCATTCCGCAGCCTTTTCGCGATCCCCCGACAGTTATTGACTGAGACCACATCTCTCGGAGGTCGGTCGGCA
TTTAGCAGTCAGCTCAGATGCAATCAACGAGGTCTCGCAACGGTGGTACCGCCAGTCACACAAAATGCGACAGGT
TCCAAGGGCCCGACAGCTATTGTTTTTATGAACATGGGTGGACCTTCTACAACGGACGAGGTGGAGGACTTTTTG
AGCAGACTATTTGTACGAGTCATAAATGGCTACATTGGCCACGTTGAATTGATATGCTAACACATGAACTACAGG
CTGACGGTGATTTGATTCCCCTGGGACGACTCCAATCGTATATCGGCCCCCTCATCGCACGTCGGAGAACCTCGA
AGATTCAAAAGCAGTACGCAAGTATCGGCGGCGGATCGCCCATTCGGAAATGGTCCGAGTATCAATGCGCAGAAA
TGTGCAAGTTATTGGATAAGATCTCCCCGGAGACCGCGCCGCATAAACCTTATGTCGCCTTCCGCTACGCTGCCC
CATTGACCGAGACCATGTATAAGCAGCTTTTCGCCGATGGGTTTGGCAATGGCAAGGGAGGACGTGCTGTCGCGT
TTACACAGTACCCGCAGTACTCCTGCTCAACGACCGGCAGTTCCCTTAACGAGCTGTGGAAGTGGCGTAATCGTC
TCGAGGGAAAGCGCCCTAATGGAGGGTCCGAGCCAGCTGGCGCAATCCAGTGGAGTGTCATTGACCGTTGGCCTT
CTCACTCTGGTCTTGTGGAGGCGTTCGCACAAAATATCGAGGCTCAACTCAAGACATACCCAGAGGAGAAGCGAG
ACCAGGTCGTGTTGCTGTTCTCGGCCCACAGCTTGCCTATGAGCGTTGTCAACCGAGGTAGGCTATGTCCCCGAT
TACTCTCTAGAATTACACTAATTATTCTCTCACACAGGTGATACCTACCCGGCCGAAGTTGCAGCGACAGTTCAT
GCCGTTATGCAACGACTCAAGTTCAAGAACCCATACCGCCTGTGCTGGCAATCACAGGTCGGACCTAGTGCGTGG
CTCGGGGCTCAGACAGCTGATACCGTTCAAGAGTATGTGAAACGAGGACAGACGGACTTGATCCTGATTCCCATT
GCGTTTACAAGCGACCACATCGAGACACTGTTTGAGCTGGATCAGGAAGTCATCCATGATGCCAACAACCCGGGT
GTCAAGCGCGCGGAGAGCTTGAATGGAAACCCGGTTTTCATCCAGGCACTTGCCGATATTGCCCGCGACCACTTG
CAAAAGGGAGAATTGTGTTCTACCCAGATGACACTGCGTTGCCAGGGCTGCACCAGCGAGCGGTGCTTGGGTCAG
AAGAAATTCTTTGCCGGCCAGGAACATGCTTCTATGGTGGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail