Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3393.t1
Gene name
Locationscaffold_05:556364..558181
Strand-
Gene length (bp)1817
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-18 136 397
PF00083 Sugar_tr Sugar (and other) transporter 2.4E-07 149 291

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 130 152 22
3 228 250 22
4 255 277 22
5 348 370 22
6 385 407 22
7 428 447 19
8 453 475 22
9 488 510 22
10 520 539 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 51.48 31.16 71.79
5d_25C Five days - 25 degrees Celsius 43.79 26.24 61.35
7d_25C Seven days - 25 degrees Celsius 40.54 24.18 56.90
10d_25C Ten days - 25 degrees Celsius 33.30 19.35 47.24
7d_15C Seven days - 15 degrees Celsius 61.08 37.14 85.03
7d_30C Seven days - 30 degrees Celsius 27.18 15.10 39.25

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.547156 no
3d_25C 7d_25C 0.319079 no
3d_25C 7d_15C 0.504261 no
3d_25C 7d_30C 0.001804 yes
3d_25C 10d_25C 0.041216 yes
5d_25C 7d_25C 0.802720 no
5d_25C 7d_15C 0.132943 no
5d_25C 7d_30C 0.032612 yes
5d_25C 10d_25C 0.256675 no
7d_25C 7d_15C 0.057236 no
7d_25C 7d_30C 0.081550 no
7d_25C 10d_25C 0.450199 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.003197 yes
7d_30C 10d_25C 0.464748 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3393.t1
MENEELFVGDPDIAELHTARETRPIEHVTENTPLIDEADGLHRRSFDLTNNRPKGRRASIWWLLPFGVLFTLGFG
GMAVPKINLVMSLICRDYLAEKTTQDPGFTYLPVIFGDNNPQCQIPQVQSLVAQFQLYLNLIAGILSALVSPRFG
HLSDRYGRTKMIALGAMGAVLNEVITVIVAKWPERVSVNMLLVGAVMDGLGGSFTTAQALIHSYASDCTPTEKRS
VAFGLFHGALFFGIAAGPGGAAFLIKHGGTLPVFYIALAFHATFCLSVFFIVPESLSKERQLAAREKHRLKIVDT
DSPKWYSWRVWNPVNLFTPLSILMPAVGKPSALFPNRRGASPALRRNIILLAAIDTAVFGVALGTVQVIIIYAEY
MFNWGSVESSLFVATVNVVRVINLFLVLPLISMFFRTPCVEDGNIRGSDMLDIVLIRTSIIFDILGYIGYALSKT
PSIMVISGVVASLGGMGSAILQSSLTKHVPHERIGQMLGATGLLHALARVVAPTVFNLIYSLTVATLPQVVFVAL
AAVFGVAFLMSLLIRSHVTLEAGPPTDLRLEEDADEHDGLLR*
Coding >Pro_DTO377G3_2|g3393.t1
ATGGAGAACGAAGAACTCTTTGTGGGGGATCCCGATATTGCGGAGCTGCACACAGCTCGAGAGACTCGTCCGATT
GAACATGTAACCGAAAACACGCCTCTAATTGATGAAGCCGATGGGCTGCATCGACGGTCTTTTGACCTTACGAAT
AATCGGCCGAAAGGGAGGAGAGCGAGTATTTGGTGGCTGCTCCCATTTGGTGTCCTTTTTACCCTGGGTTTTGGT
GGAATGGCTGTGCCCAAGATCAATTTGGTCATGTCGCTCATCTGCCGAGATTATCTCGCCGAGAAGACCACCCAA
GACCCCGGATTCACCTATCTCCCTGTTATATTTGGGGATAATAATCCACAGTGCCAGATACCGCAAGTTCAGTCG
TTGGTTGCTCAGTTCCAGCTCTATCTCAATCTTATTGCGGGTATTCTATCAGCCTTAGTGAGTCCCCGGTTCGGG
CACTTATCCGATCGCTACGGGAGAACCAAAATGATCGCGCTGGGCGCGATGGGCGCGGTACTCAATGAGGTTATC
ACTGTCATTGTGGCTAAATGGCCAGAGCGGGTCTCGGTCAATATGCTTCTAGTTGGAGCAGTCATGGATGGACTG
GGTGGATCATTTACAACCGCACAGGCTTTGATCCATTCCTATGCCTCTGACTGCACGCCCACTGAAAAACGAAGC
GTGGCATTCGGTCTCTTCCACGGTGCTTTGTTCTTTGGAATTGCAGCTGGACCAGGCGGTGCCGCATTTTTGATC
AAGCATGGAGGCACGCTACCCGTCTTCTACATTGCGCTTGCATTCCATGCAACTTTCTGTCTATCGGTCTTCTTC
ATCGTGCCTGAATCTTTGTCCAAGGAACGACAGCTCGCGGCCCGCGAGAAGCATCGCTTGAAAATTGTGGATACT
GACTCTCCTAAATGGTACTCTTGGCGTGTCTGGAACCCAGTGAACTTGTTCACTCCGCTTTCAATTCTGATGCCC
GCCGTTGGAAAGCCGAGTGCCTTGTTCCCCAACCGCCGCGGTGCCAGTCCGGCTCTACGCCGGAATATCATTCTG
CTGGCTGCTATCGATACTGCTGTCTTTGGAGTCGCCCTGGGCACGGTACAGGTTATCATCATCTACGCCGAATAC
ATGTTCAACTGGGGCAGCGTGGAGTCCAGTCTGTTTGTAGCGACCGTTAATGTGGTGCGAGTGATCAATCTTTTC
CTGGTGCTTCCGCTTATATCCATGTTCTTCCGCACCCCGTGCGTGGAAGACGGAAACATTCGCGGCTCGGACATG
CTGGACATTGTTCTAATCCGCACATCTATAATATTCGATATTTTGGGCTACATTGGCTATGCTCTGTCCAAGACA
CCATCAATCATGGTGATTTCTGGTGTCGTCGCCTCGCTAGGTGGCATGGGTTCTGCAATTCTGCAGTCATCTCTG
ACCAAGCATGTGCCGCATGAACGCATTGGACAGATGCTCGGCGCCACTGGTCTTTTGCATGCTCTTGCTCGAGTT
GTTGCACCTACTGTATTTAACTTAATCTATAGTCTGACGGTTGCAACATTACCTCAGGTAGTGTTTGTGGCCCTT
GCGGCTGTTTTTGGTGTAGCATTCCTCATGAGTCTGCTAATCAGGTCGCATGTTACCCTGGAGGCTGGTCCCCCT
ACTGATCTAAGATTGGAAGAAGATGCCGACGAGCATGACGGGCTTTTGCGGTAA
Transcript >Pro_DTO377G3_2|g3393.t1
ATGGAGAACGAAGAACTCTTTGTGGGGGATCCCGATATTGCGGAGCTGCACACAGCTCGAGAGACTCGTCCGATT
GAACATGTAACCGAAAACACGCCTCTAATTGATGAAGCCGATGGGCTGCATCGACGGTCTTTTGACCTTACGAAT
AATCGGCCGAAAGGGAGGAGAGCGAGTATTTGGTGGCTGCTCCCATTTGGTGTCCTTTTTACCCTGGGTTTTGGT
GGAATGGCTGTGCCCAAGATCAATTTGGTCATGTCGCTCATCTGCCGAGATTATCTCGCCGAGAAGACCACCCAA
GACCCCGGATTCACCTATCTCCCTGTTATATTTGGGGATAATAATCCACAGTGCCAGATACCGCAAGTTCAGTCG
TTGGTTGCTCAGTTCCAGCTCTATCTCAATCTTATTGCGGGTATTCTATCAGCCTTAGTGAGTCCCCGGTTCGGG
CACTTATCCGATCGCTACGGGAGAACCAAAATGATCGCGCTGGGCGCGATGGGCGCGGTACTCAATGAGGTTATC
ACTGTCATTGTGGCTAAATGGCCAGAGCGGGTCTCGGTCAATATGCTTCTAGTTGGAGCAGTCATGGATGGACTG
GGTGGATCATTTACAACCGCACAGGCTTTGATCCATTCCTATGCCTCTGACTGCACGCCCACTGAAAAACGAAGC
GTGGCATTCGGTCTCTTCCACGGTGCTTTGTTCTTTGGAATTGCAGCTGGACCAGGCGGTGCCGCATTTTTGATC
AAGCATGGAGGCACGCTACCCGTCTTCTACATTGCGCTTGCATTCCATGCAACTTTCTGTCTATCGGTCTTCTTC
ATCGTGCCTGAATCTTTGTCCAAGGAACGACAGCTCGCGGCCCGCGAGAAGCATCGCTTGAAAATTGTGGATACT
GACTCTCCTAAATGGTACTCTTGGCGTGTCTGGAACCCAGTGAACTTGTTCACTCCGCTTTCAATTCTGATGCCC
GCCGTTGGAAAGCCGAGTGCCTTGTTCCCCAACCGCCGCGGTGCCAGTCCGGCTCTACGCCGGAATATCATTCTG
CTGGCTGCTATCGATACTGCTGTCTTTGGAGTCGCCCTGGGCACGGTACAGGTTATCATCATCTACGCCGAATAC
ATGTTCAACTGGGGCAGCGTGGAGTCCAGTCTGTTTGTAGCGACCGTTAATGTGGTGCGAGTGATCAATCTTTTC
CTGGTGCTTCCGCTTATATCCATGTTCTTCCGCACCCCGTGCGTGGAAGACGGAAACATTCGCGGCTCGGACATG
CTGGACATTGTTCTAATCCGCACATCTATAATATTCGATATTTTGGGCTACATTGGCTATGCTCTGTCCAAGACA
CCATCAATCATGGTGATTTCTGGTGTCGTCGCCTCGCTAGGTGGCATGGGTTCTGCAATTCTGCAGTCATCTCTG
ACCAAGCATGTGCCGCATGAACGCATTGGACAGATGCTCGGCGCCACTGGTCTTTTGCATGCTCTTGCTCGAGTT
GTTGCACCTACTGTATTTAACTTAATCTATAGTCTGACGGTTGCAACATTACCTCAGGTAGTGTTTGTGGCCCTT
GCGGCTGTTTTTGGTGTAGCATTCCTCATGAGTCTGCTAATCAGGTCGCATGTTACCCTGGAGGCTGGTCCCCCT
ACTGATCTAAGATTGGAAGAAGATGCCGACGAGCATGACGGGCTTTTGCGGTAA
Gene >Pro_DTO377G3_2|g3393.t1
ATGGAGAACGAAGAACTCTTTGTGGGGGATCCCGATATTGCGGAGCTGCACACAGCTCGAGAGACTCGTCCGATT
GAACATGTAACCGAAAACACGCCTCTAATTGATGAAGCCGATGGGCTGCATCGACGGTCTTTTGACCTTACGAAT
AATCGGCCGAAAGGGAGGAGAGCGAGTGTGAGTGACTGATTTACGACCAAAGCGTCGGAAACAACTGTCTAATCT
GCAAACATGACAGATTTGGTGGCTGCTCCCATTTGGTGTCCTTTTTACCCTGGGTTTTGGTGGAATGGCTGTGCC
CAAGATCAATTTGGTCATGTCGCTCATCTGCCGAGATTATCTCGCCGAGAAGACCACCCAAGACCCCGGATTCAC
CTATCTCCCTGTTATATTTGGGGATAATAATCCACAGTGCCAGATACCGCAAGTTCAGTCGTTGGTTGCTCAGTT
CCAGCTCTATCTCAATCTTATTGCGGGTATTCTATCAGCCTTAGTGAGTCCCCGGTTCGGGCACTTATCCGATCG
CTACGGGAGAACCAAAATGATCGCGCTGGGCGCGATGGGCGCGGTACTCAATGAGGTTATCACTGTCATTGTGGC
TAAATGGCCAGAGCGGGTCTCGGTCAATATGCTTCTAGTTGGAGCAGTCATGGATGGACTGGGTGGATCATTTAC
AACCGCACAGGCTTTGATCCATTCCTATGCCTCTGACTGCACGCCCACTGAAAAACGAAGCGTGGCATTCGGTCT
CTTCCACGGTGCTTTGTTCTTTGGAATTGCAGCTGGACCAGGCGGTGCCGCATTTTTGATCAAGCATGGAGGCAC
GCTACCCGTCTTCTACATTGCGCTTGCATTCCATGCAACTTTCTGTCTATCGGTCTTCTTCATCGTGCCTGAATC
TTTGTCCAAGGAACGACAGCTCGCGGCCCGCGAGAAGCATCGCTTGAAAATTGTGGATACTGACTCTCCTAAATG
GTACTCTTGGCGTGTCTGGAACCCAGTGAACTTGTTCACTCCGCTTTCAATTCTGATGCCCGCCGTTGGAAAGCC
GAGTGCCTTGTTCCCCAACCGCCGCGGTGCCAGTCCGGCTCTACGCCGGAATATCATTCTGCTGGCTGCTATCGA
TACTGCTGTCTTTGGAGTCGCCCTGGGCACGGTACAGGTTATCATCATCTACGCCGAATACATGTTCAACTGGGG
CAGCGTGGAGTCCAGTCTGTTTGTAGCGACCGTTAATGTGGTGCGAGTGATCAATCTTTTCCTGGTGCTTCCGCT
TATATCCATGTTCTTCCGCACCCCGTGCGTGGAAGACGGAAACATTCGCGGCTCGGACATGCTGGACATTGTTCT
AATCCGCACATCTATAATATTCGATATTTTGGGCTACATTGGCTATGCTCTGTCCAAGACACCATCAATCATGGT
GATTTCTGGTGTCGTCGCCTCGCTAGGTGGCATGGGTTCTGCAATTCTGCAGTCATCTCTGACCAAGCATGTGCC
GCATGAACGCATTGGACAGATGCTCGGCGCCACTGGTCTTTTGCATGCTCTTGCTCGAGTTGTTGCACCTACTGT
ATTTAACTTAATCTATAGTCTGACGGTTGCAACATTACCTCAGGTAGTGTTTGTGGCCCTTGCGGCTGTTTTTGG
TGTAGCATTCCTCATGAGTCTGCTAATCAGGTCGCATGGTATGTTTATTCTCCCGATCTCCTACAAGAAGTATAC
TAATTACTGTGACAGTTACCCTGGAGGCTGGTCCCCCTACTGATCTAAGATTGGAAGAAGATGCCGACGAGCATG
ACGGGCTTTTGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail