Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3382.t1
Gene name
Locationscaffold_05:522442..523899
Strand-
Gene length (bp)1457
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02076 STE3 Pheromone A receptor 3.7E-91 15 300

GO

GO Term Description Terminal node
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0016021 integral component of membrane Yes
GO:0004932 mating-type factor pheromone receptor activity Yes
GO:0004930 G protein-coupled receptor activity No
GO:0001653 peptide receptor activity No
GO:0060089 molecular transducer activity No
GO:0008150 biological_process No
GO:0008528 G protein-coupled peptide receptor activity No
GO:0005575 cellular_component No
GO:0016503 pheromone receptor activity No
GO:0038023 signaling receptor activity No
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0003674 molecular_function No
GO:0031224 intrinsic component of membrane No
GO:0007165 signal transduction No
GO:0110165 cellular anatomical entity No
GO:0004888 transmembrane signaling receptor activity No
GO:0050794 regulation of cellular process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 39 61 22
3 81 103 22
4 124 143 19
5 168 190 22
6 215 237 22
7 276 293 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3382.t1
MDIHHRYPQAVALPILSIFSIALAIPPLILHGKNRNFPATSLIFWSILLNLFNIINSLIWPTDDVASWWDGAGLC
DIEVKFMAAGYVGIPGSLACIFRSLAIVLDTDRATLVPSRGQRWRNQCMEILFCVAVPVTAMITHIIWQKSRYLL
FAISGCVNNFDESWVSLVFAWIWPPIICLIAAYYCCLVLIRVHKYRSDFANILRASSSNLSKSRFLRLFFLALSM
LVCILPLQGYVVYTDIILSLPWHSYSWSRIHNGEWNTITKVPIDGTVFFDRWTPVASGFMIFIFFGFGRDATRMY
RTVFWYLGLGYCFPSIEPPTDTHNSGPSAAHASTATTLVGSIGSRAKSMFSRQKESFATFVSTHGTYNDIEKGSS
SPLSRYTRSTRNSRWNSLPWSLFNRRQTRQDIDGTLLNDLPVGTSLTVSSNAWASRRDSRDLSSGPSSPKLSKDF
IHVRQVISQQSEVRIQV*
Coding >Pro_DTO377G3_2|g3382.t1
ATGGATATTCACCACAGATACCCGCAGGCCGTGGCTCTACCAATTCTATCTATTTTCTCCATTGCTCTCGCTATT
CCGCCATTAATTCTGCATGGAAAGAACCGAAATTTCCCTGCTACTAGTCTGATATTCTGGTCAATCCTCCTCAAC
TTGTTCAACATCATCAATTCTCTCATATGGCCCACGGACGACGTGGCGTCGTGGTGGGATGGAGCTGGTCTCTGT
GATATCGAGGTCAAGTTTATGGCTGCCGGCTACGTGGGCATCCCAGGAAGCCTGGCATGCATCTTTCGAAGTCTT
GCAATCGTACTGGATACAGACCGGGCCACATTAGTCCCGAGCAGAGGTCAACGCTGGCGCAACCAGTGCATGGAG
ATTCTGTTCTGCGTTGCTGTTCCAGTCACCGCAATGATCACACATATCATCTGGCAGAAGAGCCGATACTTGCTA
TTTGCCATCTCGGGATGTGTGAACAACTTCGACGAGAGCTGGGTTAGTCTCGTCTTTGCATGGATCTGGCCGCCG
ATTATCTGCCTCATTGCAGCATATTATTGCTGCCTGGTCCTCATCCGCGTACACAAGTACCGAAGCGACTTCGCA
AACATCCTCCGCGCCTCCAGCAGCAACCTCAGCAAATCCCGCTTCCTCCGTCTCTTCTTCCTGGCCCTATCAATG
CTTGTCTGCATCCTCCCACTTCAAGGCTACGTCGTCTACACCGACATCATCCTCTCCCTCCCCTGGCACAGCTAC
TCCTGGAGCAGAATCCACAACGGAGAATGGAACACCATCACCAAAGTCCCCATCGACGGCACAGTCTTCTTCGAC
CGCTGGACCCCCGTCGCATCAGGCTTCATGATCTTCATCTTCTTCGGCTTCGGCCGCGACGCAACCCGCATGTAC
CGCACAGTCTTCTGGTACCTCGGACTGGGCTACTGCTTCCCGAGCATCGAGCCCCCAACCGATACGCACAACTCC
GGCCCTTCAGCGGCGCACGCCTCAACAGCAACCACGCTCGTCGGCAGCATCGGCTCCCGTGCGAAATCAATGTTC
TCGCGACAGAAGGAATCCTTCGCTACGTTTGTCTCGACGCATGGCACATACAACGATATCGAAAAGGGCTCTTCC
TCGCCCTTGTCCCGTTATACCAGGTCTACCAGGAACTCGCGCTGGAATAGCTTGCCCTGGTCGCTCTTTAACAGA
CGCCAGACTCGTCAGGATATAGATGGGACGCTGCTGAATGACCTCCCCGTTGGTACTTCGCTGACTGTATCCTCG
AATGCTTGGGCTAGTCGTCGTGATAGCCGGGATCTGTCTAGTGGACCTAGTTCGCCTAAGCTTAGTAAGGATTTC
ATTCATGTGCGCCAGGTTATTAGCCAGCAGAGCGAGGTCAGGATTCAGGTCTAG
Transcript >Pro_DTO377G3_2|g3382.t1
ATGGATATTCACCACAGATACCCGCAGGCCGTGGCTCTACCAATTCTATCTATTTTCTCCATTGCTCTCGCTATT
CCGCCATTAATTCTGCATGGAAAGAACCGAAATTTCCCTGCTACTAGTCTGATATTCTGGTCAATCCTCCTCAAC
TTGTTCAACATCATCAATTCTCTCATATGGCCCACGGACGACGTGGCGTCGTGGTGGGATGGAGCTGGTCTCTGT
GATATCGAGGTCAAGTTTATGGCTGCCGGCTACGTGGGCATCCCAGGAAGCCTGGCATGCATCTTTCGAAGTCTT
GCAATCGTACTGGATACAGACCGGGCCACATTAGTCCCGAGCAGAGGTCAACGCTGGCGCAACCAGTGCATGGAG
ATTCTGTTCTGCGTTGCTGTTCCAGTCACCGCAATGATCACACATATCATCTGGCAGAAGAGCCGATACTTGCTA
TTTGCCATCTCGGGATGTGTGAACAACTTCGACGAGAGCTGGGTTAGTCTCGTCTTTGCATGGATCTGGCCGCCG
ATTATCTGCCTCATTGCAGCATATTATTGCTGCCTGGTCCTCATCCGCGTACACAAGTACCGAAGCGACTTCGCA
AACATCCTCCGCGCCTCCAGCAGCAACCTCAGCAAATCCCGCTTCCTCCGTCTCTTCTTCCTGGCCCTATCAATG
CTTGTCTGCATCCTCCCACTTCAAGGCTACGTCGTCTACACCGACATCATCCTCTCCCTCCCCTGGCACAGCTAC
TCCTGGAGCAGAATCCACAACGGAGAATGGAACACCATCACCAAAGTCCCCATCGACGGCACAGTCTTCTTCGAC
CGCTGGACCCCCGTCGCATCAGGCTTCATGATCTTCATCTTCTTCGGCTTCGGCCGCGACGCAACCCGCATGTAC
CGCACAGTCTTCTGGTACCTCGGACTGGGCTACTGCTTCCCGAGCATCGAGCCCCCAACCGATACGCACAACTCC
GGCCCTTCAGCGGCGCACGCCTCAACAGCAACCACGCTCGTCGGCAGCATCGGCTCCCGTGCGAAATCAATGTTC
TCGCGACAGAAGGAATCCTTCGCTACGTTTGTCTCGACGCATGGCACATACAACGATATCGAAAAGGGCTCTTCC
TCGCCCTTGTCCCGTTATACCAGGTCTACCAGGAACTCGCGCTGGAATAGCTTGCCCTGGTCGCTCTTTAACAGA
CGCCAGACTCGTCAGGATATAGATGGGACGCTGCTGAATGACCTCCCCGTTGGTACTTCGCTGACTGTATCCTCG
AATGCTTGGGCTAGTCGTCGTGATAGCCGGGATCTGTCTAGTGGACCTAGTTCGCCTAAGCTTAGTAAGGATTTC
ATTCATGTGCGCCAGGTTATTAGCCAGCAGAGCGAGGTCAGGATTCAGGTCTAG
Gene >Pro_DTO377G3_2|g3382.t1
ATGGATATTCACCACAGATACCCGCAGGCCGTGGCTCTACCAATTCTATCTATTTTCTCCATTGCTCTCGCTATT
CCGCCATTAATTCTGCATGGAAAGAACCGAAATTTCCCTGCTACTAGTCTGATATTCTGGTCAATCCTCCTCAAC
TTGTTCAACATCATCAATTCTCTCATATGGCCCACGGACGACGTGGCGTCGTGGTGGGATGGAGCTGGTCTCTGT
GATATCGAGGTCAAGTTTATGGCTGCCGGCTACGTGGGCATCCCAGGAAGCCTGGCATGCATCTTTCGAAGTCTT
GCAATCGTACTGGATACAGACCGGGCCACATTAGTCCCGAGCAGAGGTCAACGCTGGCGCAACCAGTGCATGGAG
ATTCTGTTCTGCGTTGCTGTTCCAGTCACCGCAATGATCACACATATCATCTGGCAGAAGAGCCGATACTTGCTA
TTTGCCATCTCGGGATGTGTGAACAACTTCGACGAGAGCTGGGTTAGTCTCGTCTTTGCATGGATCTGGCCGCCG
ATTATCTGCCTCATTGCAGCATATTATTGCTGTAAGTATACTCCCAACTCACTTCAAAAACACTCCATTAACCAA
ATATCACAGGCCTGGTCCTCATCCGCGTACACAAGTACCGAAGCGACTTCGCAAACATCCTCCGCGCCTCCAGCA
GCAACCTCAGCAAATCCCGCTTCCTCCGTCTCTTCTTCCTGGCCCTATCAATGCTTGTCTGCATCCTCCCACTTC
AAGGCTACGTCGTCTACACCGACATCATCCTCTCCCTCCCCTGGCACAGCTACTCCTGGAGCAGAATCCACAACG
GAGAATGGAACACCATCACCAAAGTCCCCATCGACGGCACAGTCTTCTTCGACCGCTGGACCCCCGTCGCATCAG
GCTTCATGATCTTCATCTTCTTCGGCTTCGGCCGCGACGCAACCCGCATGTACCGCACAGTCTTCTGGTACCTCG
GACTGGGCTACTGCTTCCCGAGCATCGAGCCCCCAACCGATACGCACAACTCCGGCCCTTCAGCGGCGCACGCCT
CAACAGCAACCACGCTCGTCGGCAGCATCGGCTCCCGTGCGAAATCAATGTTCTCGCGACAGAAGGAATCCTTCG
CTACGTTTGTCTCGACGCATGGCACATACAACGATATCGAAAAGGGCTCTTCCTCGCCCTTGTCCCGTTATACCA
GGTCTACCAGGAACTCGCGCTGGAATAGCTTGCCCTGGTCGCTCTTTAACAGACGCCAGACTCGTCAGGATATAG
ATGGGACGCTGCTGAATGACCTCCCCGTTGGTACTTCGCTGACTGTATCCTCGAATGCTTGGGCTAGTCGTCGTG
ATAGCCGGGATCTGTCTAGTGGACCTAGTTCGCCTAAGCTTAGTAAGGATTTCATTCATGTGCGCCAGGTTATTA
GCCAGCAGAGCGAGGTCAGGATTCAGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail