Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3364.t1
Gene name
Locationscaffold_05:457858..461877
Strand+
Gene length (bp)4019
Transcript length (bp)3699
Coding sequence length (bp)3699
Protein length (aa) 1233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 2.2E-70 201 543
PF00187 Chitin_bind_1 Chitin recognition protein 9.8E-12 141 177

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0008061 chitin binding Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0008144 drug binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 744 766 22
2 773 795 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3364.t1
MRILLPALLALASCGISQGRQQPHGKRNHAKPLPEFTPVPQLPKNSSSALPPLYQPYSKNKPKFENEALIRQLSQ
HPGLRLDHLDSGPGSMRKRDLPVGTCAPGVPCTNGACCSNTGVCSYAPSSCGADVCISNCDAKAPCGEYANPDNA
TCPLNVCCSQYGFCGSTDDFCGTGCQEGFGGCGAAPTPSCSSGSNSAAARRIGYYESWATERPCDVFTPEDLELT
GLTHINFAFSYFDPSTFQISPMDGNAATLYSRFTALKAKQPGLQTWLSVGGWSFNDATNTPDTQNAFSNMISSSA
NRQAFITSLRNFMQTYGFDGVDIDWEYPAADDRGGVPADFSNFPTFLAELRASFGSGLGISTTLPSSYWYLQHFD
VLDMEPSVDWFNFMSYDIHGVWDSSNKFTGPYLRPHTNLTEINDGLSLLWRAGVNPSKVVLGLGWYGRSFTLADP
SCTTPNGVCQFTTGGTAGECTRSSGTLSNAEIKRLLAAGTGTESYDATAGVRWLTFDTNQWVSFDDGATMQQKLA
FANSLCLGGIMIWSIDQDNTAGDSMNDLMGIGTANGVSEAAAASFKEQMANATLQNAVVSSCYWSLCGGACTTGY
FDVTDARGQIAGFQQNSVCPPGEAQTLCCAPGTSMGTCQWEGFRGVGMPCSPACSDPKATIVARNTNSYEMNDGG
QLEDLTCTGGFQAYCCTEFVPSSITNSGNLLLYGQTPVLSKRDGSNHGLSLYVGDHAVEKRSLPLLVSGLGALCL
ADLLPSILSAPLTFGLSLAAEGAICAATAAAVVATAAIIGFSILYNLVGWIFGGSPSKPNVGVPTTVAGRSSYGQ
WPILDFSGGTTTSTCDCVVTYTCRYGMGWDEICDNQRWGIDKLLNGKTVYQPLPTSRAAGANQGLWKGQRIEAYR
TAAQLKLPGKTWRCQVDEFPMGNLAESGNNAPQACRLVNGPANAKQGNDYKMWKSAQWKPCSTYRSAVCNSRDSG
PPATWAFGVLPAGRGSGSGKHFIDAYGFDEQTAGSLCWATYTYTEQPGTISTSTPVDHGFRVLDDDPMYGNAYGW
PRQSWRIDPAPLANMADRPYDSQPTIFQRGLLANDTWPEEHSDPAGVCHADLRSLGDDKQDAYLDLDYDNLLFVD
LDGKPVDGRTCNIIYEDDDPHSEVRIVLDENGKVVEIYMGDPDAGLWTREALKSSNSDKVTVDPTTVTVMTGVPA
GSESRPTFPASTTGLQTRSGTVVTPAPYVYGL*
Coding >Pro_DTO377G3_2|g3364.t1
ATGCGAATCCTTCTGCCAGCGCTTCTTGCTCTCGCAAGTTGCGGGATTTCCCAAGGTCGTCAACAACCCCATGGG
AAACGCAACCACGCGAAACCATTGCCAGAGTTCACTCCAGTGCCCCAATTGCCAAAGAACTCGTCTTCGGCCCTG
CCGCCCCTCTACCAGCCCTATTCAAAGAACAAACCTAAGTTCGAAAACGAGGCCCTTATCCGGCAATTGTCTCAG
CATCCAGGGCTAAGACTTGACCATCTTGACTCTGGCCCTGGCTCTATGCGCAAAAGAGACCTTCCCGTAGGCACT
TGCGCACCTGGAGTACCTTGCACAAATGGAGCATGTTGTTCAAACACTGGCGTTTGTTCCTACGCCCCCTCGAGT
TGCGGGGCTGACGTCTGCATTTCCAACTGCGACGCGAAAGCTCCTTGTGGGGAATACGCCAACCCCGATAACGCA
ACGTGCCCGCTGAACGTGTGTTGTTCGCAATATGGATTTTGCGGCAGCACTGATGACTTCTGTGGCACTGGTTGT
CAGGAGGGGTTTGGCGGCTGTGGAGCAGCTCCGACTCCTTCTTGCTCTAGTGGTAGCAACTCTGCGGCTGCGCGG
CGCATCGGGTACTACGAGAGCTGGGCGACCGAGCGGCCATGTGATGTTTTTACACCTGAAGACCTCGAGCTGACG
GGTCTGACGCACATCAATTTTGCTTTCTCATACTTCGACCCATCTACTTTCCAGATCTCGCCGATGGACGGAAAT
GCGGCCACACTTTATTCGCGCTTCACGGCGCTTAAGGCAAAACAGCCAGGACTGCAGACGTGGCTATCAGTTGGC
GGCTGGTCTTTCAATGATGCAACGAATACGCCAGACACACAGAATGCTTTCAGTAACATGATCAGCTCCTCGGCA
AATCGCCAAGCCTTCATCACTTCCCTGCGCAATTTCATGCAGACATACGGCTTTGACGGCGTGGACATTGACTGG
GAATACCCTGCTGCCGACGATCGAGGCGGTGTCCCAGCCGATTTCTCCAATTTCCCAACCTTCCTGGCTGAATTG
AGGGCCTCGTTCGGTAGCGGATTGGGAATCAGTACTACACTTCCATCTTCATACTGGTATCTTCAGCATTTTGAC
GTTCTGGACATGGAGCCTAGCGTCGACTGGTTCAACTTCATGAGCTACGACATCCATGGCGTCTGGGACTCGAGC
AACAAGTTCACGGGGCCTTACCTCCGCCCGCACACCAATCTCACTGAAATCAACGACGGCTTGTCCCTGCTGTGG
AGGGCCGGAGTTAACCCATCCAAGGTTGTGCTTGGGCTGGGCTGGTATGGGCGCTCCTTTACGCTCGCTGATCCG
TCTTGTACCACGCCTAACGGCGTATGTCAGTTCACCACCGGCGGTACTGCGGGAGAGTGCACACGGTCATCCGGG
ACGCTTTCCAACGCCGAGATCAAACGTCTTCTAGCGGCCGGAACGGGAACCGAATCATATGATGCCACTGCAGGA
GTCCGCTGGCTCACCTTTGATACGAACCAGTGGGTAAGCTTCGACGATGGAGCGACAATGCAGCAGAAGCTGGCC
TTCGCTAATAGCCTGTGCCTTGGGGGTATCATGATTTGGTCGATCGATCAGGACAACACAGCTGGCGACAGTATG
AACGACTTGATGGGCATCGGTACAGCAAATGGGGTGTCAGAGGCAGCTGCCGCTTCATTCAAGGAGCAGATGGCT
AATGCTACGCTGCAGAACGCTGTTGTATCGAGCTGCTACTGGTCACTATGCGGAGGGGCCTGTACGACCGGGTAT
TTTGATGTAACTGATGCCCGCGGCCAGATTGCCGGCTTCCAGCAGAACTCCGTATGCCCTCCAGGCGAAGCCCAG
ACACTATGTTGCGCCCCAGGAACCTCGATGGGCACCTGTCAATGGGAGGGTTTCAGGGGCGTGGGAATGCCTTGC
TCACCGGCATGCTCTGACCCCAAGGCCACCATTGTCGCCCGTAATACCAACTCGTACGAGATGAACGATGGAGGT
CAGCTTGAAGATCTGACTTGTACTGGTGGCTTCCAAGCATATTGCTGCACGGAATTTGTCCCTTCGTCGATCACC
AATTCAGGCAACCTCTTGCTCTATGGCCAGACTCCTGTGCTCAGCAAGCGAGACGGTTCTAATCATGGCCTCAGT
CTCTATGTAGGCGACCACGCGGTTGAAAAGCGTTCTTTACCCTTGCTAGTCTCCGGGTTGGGCGCTCTCTGCCTC
GCTGACTTGCTCCCATCGATCCTTTCAGCACCGTTGACTTTTGGCCTATCTCTTGCCGCGGAGGGGGCAATATGC
GCTGCTACGGCCGCTGCCGTCGTCGCTACTGCGGCCATCATCGGCTTTTCAATTCTTTACAACCTGGTTGGGTGG
ATTTTCGGCGGATCCCCATCTAAACCCAACGTTGGCGTCCCAACAACAGTAGCGGGCCGGTCTTCGTATGGCCAG
TGGCCGATTCTCGACTTTAGCGGCGGCACCACGACGAGTACCTGCGATTGTGTGGTCACATATACGTGCCGCTAT
GGCATGGGTTGGGATGAGATTTGTGATAACCAAAGGTGGGGGATCGACAAGCTGCTCAACGGAAAGACTGTCTAT
CAGCCATTGCCAACGAGCCGCGCTGCCGGTGCTAACCAAGGACTATGGAAAGGCCAGCGCATAGAGGCATACCGA
ACCGCGGCCCAATTAAAGCTCCCAGGCAAAACGTGGCGATGTCAAGTTGATGAGTTTCCTATGGGCAACCTCGCG
GAATCAGGAAATAACGCCCCGCAGGCTTGCCGTCTAGTCAACGGCCCTGCGAATGCAAAACAGGGAAATGATTAC
AAGATGTGGAAGTCGGCGCAGTGGAAACCTTGCTCGACATACCGCTCTGCCGTGTGCAACAGTAGGGACAGTGGG
CCGCCTGCAACCTGGGCGTTTGGGGTGCTACCCGCGGGTCGCGGTAGTGGCAGTGGAAAACACTTCATAGATGCT
TATGGTTTCGACGAGCAAACGGCCGGCTCGCTTTGCTGGGCTACATACACTTACACCGAGCAGCCTGGAACTATC
AGCACCTCCACGCCTGTCGACCATGGCTTCCGCGTTCTTGATGATGATCCCATGTACGGTAACGCCTATGGGTGG
CCTCGACAGTCCTGGCGCATCGATCCAGCTCCATTAGCGAACATGGCAGACCGGCCGTATGACTCCCAACCGACA
ATATTCCAAAGAGGCCTTCTCGCCAACGACACATGGCCCGAGGAGCATAGCGACCCCGCTGGCGTCTGCCACGCT
GACCTCAGATCACTTGGCGATGACAAACAGGATGCTTATCTCGACCTTGATTATGATAATCTCCTCTTTGTCGAT
CTGGATGGCAAACCTGTCGACGGTCGGACATGCAATATCATCTACGAGGATGACGACCCGCACTCCGAAGTGCGT
ATCGTACTTGATGAGAATGGTAAGGTCGTGGAAATATATATGGGCGACCCAGATGCTGGCTTGTGGACTAGGGAG
GCGCTTAAAAGTTCCAATTCGGACAAGGTGACTGTTGATCCCACCACCGTCACTGTCATGACGGGTGTCCCGGCG
GGCAGCGAGTCCCGACCCACATTCCCTGCGAGTACGACTGGGCTCCAGACAAGATCGGGAACCGTAGTGACACCC
GCGCCGTATGTGTACGGTCTTTGA
Transcript >Pro_DTO377G3_2|g3364.t1
ATGCGAATCCTTCTGCCAGCGCTTCTTGCTCTCGCAAGTTGCGGGATTTCCCAAGGTCGTCAACAACCCCATGGG
AAACGCAACCACGCGAAACCATTGCCAGAGTTCACTCCAGTGCCCCAATTGCCAAAGAACTCGTCTTCGGCCCTG
CCGCCCCTCTACCAGCCCTATTCAAAGAACAAACCTAAGTTCGAAAACGAGGCCCTTATCCGGCAATTGTCTCAG
CATCCAGGGCTAAGACTTGACCATCTTGACTCTGGCCCTGGCTCTATGCGCAAAAGAGACCTTCCCGTAGGCACT
TGCGCACCTGGAGTACCTTGCACAAATGGAGCATGTTGTTCAAACACTGGCGTTTGTTCCTACGCCCCCTCGAGT
TGCGGGGCTGACGTCTGCATTTCCAACTGCGACGCGAAAGCTCCTTGTGGGGAATACGCCAACCCCGATAACGCA
ACGTGCCCGCTGAACGTGTGTTGTTCGCAATATGGATTTTGCGGCAGCACTGATGACTTCTGTGGCACTGGTTGT
CAGGAGGGGTTTGGCGGCTGTGGAGCAGCTCCGACTCCTTCTTGCTCTAGTGGTAGCAACTCTGCGGCTGCGCGG
CGCATCGGGTACTACGAGAGCTGGGCGACCGAGCGGCCATGTGATGTTTTTACACCTGAAGACCTCGAGCTGACG
GGTCTGACGCACATCAATTTTGCTTTCTCATACTTCGACCCATCTACTTTCCAGATCTCGCCGATGGACGGAAAT
GCGGCCACACTTTATTCGCGCTTCACGGCGCTTAAGGCAAAACAGCCAGGACTGCAGACGTGGCTATCAGTTGGC
GGCTGGTCTTTCAATGATGCAACGAATACGCCAGACACACAGAATGCTTTCAGTAACATGATCAGCTCCTCGGCA
AATCGCCAAGCCTTCATCACTTCCCTGCGCAATTTCATGCAGACATACGGCTTTGACGGCGTGGACATTGACTGG
GAATACCCTGCTGCCGACGATCGAGGCGGTGTCCCAGCCGATTTCTCCAATTTCCCAACCTTCCTGGCTGAATTG
AGGGCCTCGTTCGGTAGCGGATTGGGAATCAGTACTACACTTCCATCTTCATACTGGTATCTTCAGCATTTTGAC
GTTCTGGACATGGAGCCTAGCGTCGACTGGTTCAACTTCATGAGCTACGACATCCATGGCGTCTGGGACTCGAGC
AACAAGTTCACGGGGCCTTACCTCCGCCCGCACACCAATCTCACTGAAATCAACGACGGCTTGTCCCTGCTGTGG
AGGGCCGGAGTTAACCCATCCAAGGTTGTGCTTGGGCTGGGCTGGTATGGGCGCTCCTTTACGCTCGCTGATCCG
TCTTGTACCACGCCTAACGGCGTATGTCAGTTCACCACCGGCGGTACTGCGGGAGAGTGCACACGGTCATCCGGG
ACGCTTTCCAACGCCGAGATCAAACGTCTTCTAGCGGCCGGAACGGGAACCGAATCATATGATGCCACTGCAGGA
GTCCGCTGGCTCACCTTTGATACGAACCAGTGGGTAAGCTTCGACGATGGAGCGACAATGCAGCAGAAGCTGGCC
TTCGCTAATAGCCTGTGCCTTGGGGGTATCATGATTTGGTCGATCGATCAGGACAACACAGCTGGCGACAGTATG
AACGACTTGATGGGCATCGGTACAGCAAATGGGGTGTCAGAGGCAGCTGCCGCTTCATTCAAGGAGCAGATGGCT
AATGCTACGCTGCAGAACGCTGTTGTATCGAGCTGCTACTGGTCACTATGCGGAGGGGCCTGTACGACCGGGTAT
TTTGATGTAACTGATGCCCGCGGCCAGATTGCCGGCTTCCAGCAGAACTCCGTATGCCCTCCAGGCGAAGCCCAG
ACACTATGTTGCGCCCCAGGAACCTCGATGGGCACCTGTCAATGGGAGGGTTTCAGGGGCGTGGGAATGCCTTGC
TCACCGGCATGCTCTGACCCCAAGGCCACCATTGTCGCCCGTAATACCAACTCGTACGAGATGAACGATGGAGGT
CAGCTTGAAGATCTGACTTGTACTGGTGGCTTCCAAGCATATTGCTGCACGGAATTTGTCCCTTCGTCGATCACC
AATTCAGGCAACCTCTTGCTCTATGGCCAGACTCCTGTGCTCAGCAAGCGAGACGGTTCTAATCATGGCCTCAGT
CTCTATGTAGGCGACCACGCGGTTGAAAAGCGTTCTTTACCCTTGCTAGTCTCCGGGTTGGGCGCTCTCTGCCTC
GCTGACTTGCTCCCATCGATCCTTTCAGCACCGTTGACTTTTGGCCTATCTCTTGCCGCGGAGGGGGCAATATGC
GCTGCTACGGCCGCTGCCGTCGTCGCTACTGCGGCCATCATCGGCTTTTCAATTCTTTACAACCTGGTTGGGTGG
ATTTTCGGCGGATCCCCATCTAAACCCAACGTTGGCGTCCCAACAACAGTAGCGGGCCGGTCTTCGTATGGCCAG
TGGCCGATTCTCGACTTTAGCGGCGGCACCACGACGAGTACCTGCGATTGTGTGGTCACATATACGTGCCGCTAT
GGCATGGGTTGGGATGAGATTTGTGATAACCAAAGGTGGGGGATCGACAAGCTGCTCAACGGAAAGACTGTCTAT
CAGCCATTGCCAACGAGCCGCGCTGCCGGTGCTAACCAAGGACTATGGAAAGGCCAGCGCATAGAGGCATACCGA
ACCGCGGCCCAATTAAAGCTCCCAGGCAAAACGTGGCGATGTCAAGTTGATGAGTTTCCTATGGGCAACCTCGCG
GAATCAGGAAATAACGCCCCGCAGGCTTGCCGTCTAGTCAACGGCCCTGCGAATGCAAAACAGGGAAATGATTAC
AAGATGTGGAAGTCGGCGCAGTGGAAACCTTGCTCGACATACCGCTCTGCCGTGTGCAACAGTAGGGACAGTGGG
CCGCCTGCAACCTGGGCGTTTGGGGTGCTACCCGCGGGTCGCGGTAGTGGCAGTGGAAAACACTTCATAGATGCT
TATGGTTTCGACGAGCAAACGGCCGGCTCGCTTTGCTGGGCTACATACACTTACACCGAGCAGCCTGGAACTATC
AGCACCTCCACGCCTGTCGACCATGGCTTCCGCGTTCTTGATGATGATCCCATGTACGGTAACGCCTATGGGTGG
CCTCGACAGTCCTGGCGCATCGATCCAGCTCCATTAGCGAACATGGCAGACCGGCCGTATGACTCCCAACCGACA
ATATTCCAAAGAGGCCTTCTCGCCAACGACACATGGCCCGAGGAGCATAGCGACCCCGCTGGCGTCTGCCACGCT
GACCTCAGATCACTTGGCGATGACAAACAGGATGCTTATCTCGACCTTGATTATGATAATCTCCTCTTTGTCGAT
CTGGATGGCAAACCTGTCGACGGTCGGACATGCAATATCATCTACGAGGATGACGACCCGCACTCCGAAGTGCGT
ATCGTACTTGATGAGAATGGTAAGGTCGTGGAAATATATATGGGCGACCCAGATGCTGGCTTGTGGACTAGGGAG
GCGCTTAAAAGTTCCAATTCGGACAAGGTGACTGTTGATCCCACCACCGTCACTGTCATGACGGGTGTCCCGGCG
GGCAGCGAGTCCCGACCCACATTCCCTGCGAGTACGACTGGGCTCCAGACAAGATCGGGAACCGTAGTGACACCC
GCGCCGTATGTGTACGGTCTTTGA
Gene >Pro_DTO377G3_2|g3364.t1
ATGCGAATCCTTCTGCCAGCGCTTCTTGCTCTCGCAAGTTGCGGGATTTCCCAAGGTCGTCAACAACCCCATGGG
AAACGCAACCACGCGAAACCATTGCCAGAGTTCACTCCAGTGCCCCAATTGCCAAAGAACTCGTCTTCGGCCCTG
CCGCCCCTCTACCAGCCCTATTCAAAGAACAAACCTAAGTTCGAAAACGAGGCCCTTATCCGGCAATTGTCTCAG
CATCCAGGGCTAAGACTTGACCATCTTGACTCTGGCCCTGGCTCTATGCGCAAAAGAGACCTTCCCGTAGGCACT
TGCGCACCTGGAGTACCTTGCACAAATGGAGCATGTTGTTCAAACACTGGCGTTTGTTCCTACGCCCCCTCGAGT
TGCGGGGCTGACGTCTGCATTTCCAACTGCGACGCGAAAGCTCCTTGTGGGGAATACGCCAACCCCGATAACGCA
ACGTGCCCGCTGAACGTGTGTTGTTCGCAATATGGATTTTGTAAGCCTCAGATTCGCTTGGAAATTTCTCATTTT
TGAGAGCAGATGCTGACCCTTATTTTACCCCCCAGGCGGCAGCACTGATGACTTCTGTGGCACTGGTTGTCAGGA
GGGGTTTGGCGGCTGTGGAGCAGCTCCGACTCCTTCTTGCTCTAGTGGTAGCAACTCTGCGGCTGCGCGGCGCAT
CGGGTACTACGAGAGCTGGGCGACCGAGCGGCCATGTGATGTTTTTACACCTGAAGACCTCGAGCTGACGGGTCT
GACGCACATCAATTTTGCTTTCTCATACTTCGACCCATCTACTTTCCAGATCTCGCCGATGGACGGAAATGCGGC
CACACTTTATTCGCGCTTCACGGCGCTTAAGGCAAAACAGCCAGGACTGCAGACGTGGCTATCAGTTGGCGGCTG
GTCTTTCAATGATGCAACGAATACGCCAGACACACAGAATGCTTTCAGTAACATGATCAGCTCCTCGGCAAATCG
CCAAGCCTTCATCACTTCCCTGCGCAATTTCATGCAGACATACGGCTTTGACGGCGTGGACATTGACTGGGAATA
CCCTGCTGCCGACGATCGAGGCGGTGTCCCAGCCGATTTCTCCAATTTCCCAACCTTCCTGGCTGAATTGAGGGC
CTCGTTCGGTAGCGGATTGGGAATCAGTACTACACTTCCATCTTCATACTGGTATCTTCAGCATTTTGACGTTCT
GGACATGGAGCCTAGCGTCGACTGGTTCAACTTCATGAGCTACGACATCCATGGCGTCTGGGACTCGAGCAACAA
GTTCACGGGGCCTTACCTCCGCCCGCACACCAATCTCACTGAAATCAACGACGGCTTGTCCCTGCTGTGGAGGGC
CGGAGTTAACCCATCCAAGGTTGTGCTTGGGCTGGGCTGGTATGGGCGCTCCTTTACGCTCGCTGATCCGTCTTG
TACCACGCCTAACGGCGTATGTCAGTTCACCACCGGCGGTACTGCGGGAGAGTGCACACGGTCATCCGGGACGCT
TTCCAACGCCGAGATCAAACGTCTTCTAGCGGCCGGAACGGGAACCGAATCATATGATGCCACTGCAGGAGTCCG
CTGGCTCACCTTTGATACGAACCAGTGGGTAAGCTTCGACGATGGAGCGACAATGCAGCAGAAGCTGGCCTTCGC
TAATAGCCTGTGCCTTGGGGGTATCATGATTGTAAGAGACCACTTTTTACCACAGTCACCAATTGCCTTCCTTCG
TTTCTTATTTTTTTCTTTGCCCTCTCTCTCACTCTTAACACCATTTTCCTTTCTTTTTTTGGAAAACATCTAATC
AAGGCTTTCTTCCAGTGGTCGATCGATCAGGACAACACAGCTGGCGACAGTATGAACGACTTGATGGGCATCGGT
ACAGCAAATGGGGTGTCAGAGGCAGCTGCCGCTTCATTCAAGGAGCAGATGGCTAATGCTACGCTGCAGAACGCT
GTTGTATCGAGCTGCTACTGGTCACTATGCGGAGGGGCCTGTACGACCGGGTATTTTGATGTAACTGATGCCCGC
GGCCAGATTGCCGGCTTCCAGCAGAACTCCGTATGCCCTCCAGGCGAAGCCCAGACACTATGTTGCGCCCCAGGA
ACCTCGATGGGCACCTGTCAATGGGAGGGTTTCAGGGGCGTGGGAATGCCTTGCTCACCGGCATGCTCTGACCCC
AAGGCCACCATTGTCGCCCGTAATACCAACTCGTACGAGATGAACGATGGAGGTCAGCTTGAAGATCTGACTTGT
ACTGGTGGCTTCCAAGCATATTGCTGCACGGAATTTGTCCCTTCGTCGATCACCAATTCAGGCAACCTCTTGCTC
TATGGCCAGACTCCTGTGCTCAGCAAGCGAGACGGTTCTAATCATGGCCTCAGTCTCTATGTAGGCGACCACGCG
GTTGAAAAGCGTTCTTTACCCTTGCTAGTCTCCGGGTTGGGCGCTCTCTGCCTCGCTGACTTGCTCCCATCGATC
CTTTCAGCACCGTTGACTTTTGGCCTATCTCTTGCCGCGGAGGGGGCAATATGCGCTGCTACGGCCGCTGCCGTC
GTCGCTACTGCGGCCATCATCGGCTTTTCAATTCTTTACAACCTGGTTGGGTGGATTTTCGGCGGATCCCCATCT
AAACCCAACGTTGGCGTCCCAACAACAGTAGCGGGCCGGTCTTCGTATGGCCAGTGGCCGATTCTCGACTTTAGC
GGCGGCACCACGACGAGTACCTGCGATTGTGTGGTCACATATACGTGCCGCTATGGCATGGGTTGGGATGAGATT
TGTGATAACCAAAGGTGGGGGATCGACAAGCTGCTCAACGGAAAGACTGTCTATCAGCCATTGCCAACGAGCCGC
GCTGCCGGTGCTAACCAAGGACTATGGAAAGGCCAGCGCATAGAGGCATACCGAACCGCGGCCCAATTAAAGCTC
CCAGGCAAAACGTGGCGATGTCAAGTTGATGAGTTTCCTATGGGCAACCTCGCGGAATCAGGAAATAACGCCCCG
CAGGCTTGCCGTCTAGTCAACGGCCCTGCGAATGCAAAACAGGGAAATGATTACAAGATGTGGAAGTCGGCGCAG
TGGAAACCTTGCTCGACATACCGCTCTGCCGTGTGCAACAGTAGGGACAGTGGGCCGCCTGCAACCTGGTATGTA
AAACCGAAGCTTCCCTCATGCGATCATATCTGACCTTGAAACAGGGCGTTTGGGGTGCTACCCGCGGGTCGCGGT
AGTGGCAGTGGAAAACACTTCATAGATGCTTATGGTTTCGACGAGCAAACGGCCGGCTCGCTTTGCTGGGCTACA
TACACTTACACCGAGCAGCCTGGAACTATCAGCACCTCCACGCCTGTCGACCATGGCTTCCGCGTTCTTGATGAT
GATCCGTATGTTTCCATCTCCCAACTTTACTAGGTAGTCAATGTATAGCTGACAAGACGATGTTGATAAGCATGT
ACGGTAACGCCTATGGGTGGCCTCGACAGTCCTGGCGCATCGATCCAGCTCCATTAGCGAACATGGCAGACCGGC
CGTATGACTCCCAACCGACAATATTCCAAAGAGGCCTTCTCGCCAACGACACATGGCCCGAGGAGCATAGCGACC
CCGCTGGCGTCTGCCACGCTGACCTCAGATCACTTGGCGATGACAAACAGGATGCTTATCTCGACCTTGATTATG
ATAATCTCCTCTTTGTCGATCTGGATGGCAAACCTGTCGACGGTCGGACATGCAATATCATCTACGAGGATGACG
ACCCGCACTCCGAAGTGCGTATCGTACTTGATGAGAATGGTAAGGTCGTGGAAATATATATGGGCGACCCAGATG
CTGGCTTGTGGACTAGGGAGGCGCTTAAAAGTTCCAATTCGGACAAGGTGACTGTTGATCCCACCACCGTCACTG
TCATGACGGGTGTCCCGGCGGGCAGCGAGTCCCGACCCACATTCCCTGCGAGTACGACTGGGCTCCAGACAAGAT
CGGGAACCGTAGTGACACCCGCGCCGTATGTGTACGGTCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail