Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3363.t1
Gene name
Locationscaffold_05:454208..456593
Strand-
Gene length (bp)2385
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 1.9E-01 335 375
PF01476 LysM LysM domain 4.2E-02 423 458

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.47 0.21 2.73
5d_25C Five days - 25 degrees Celsius 0.56 0.00 1.13
7d_25C Seven days - 25 degrees Celsius 0.39 0.00 0.88
10d_25C Ten days - 25 degrees Celsius 0.21 0.00 0.50
7d_15C Seven days - 15 degrees Celsius 0.26 0.00 0.63
7d_30C Seven days - 30 degrees Celsius 1.58 0.11 3.04

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.075327 no
3d_25C 7d_25C 0.056531 no
3d_25C 7d_15C 0.023429 yes
3d_25C 7d_30C 0.928495 no
3d_25C 10d_25C 0.010411 yes
5d_25C 7d_25C 1.000000 no
5d_25C 7d_15C 1.000000 no
5d_25C 7d_30C 0.064014 no
5d_25C 10d_25C 1.000000 no
7d_25C 7d_15C 1.000000 no
7d_25C 7d_30C 0.043971 yes
7d_25C 10d_25C 1.000000 no
7d_15C 7d_30C 0.025858 yes
7d_15C 10d_25C 1.000000 no
7d_30C 10d_25C 0.006371 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3363.t1
MLFSFLRLCFVLLTAWTTWAAADFALYKNYDADALIAGLSLSSTCLAALNTTVSCNETAISLLGHGADIHFWTTA
EVENLCTTDCVSSLSFWKDNVATVCAEETTIQGNVVVKARALPLTFTYNSDLVCMKDSSSNWCFLVSQTWQGSDY
IRWDPTMCFADGDDNSTVAPECADPDFDVGDISDDMSALTNIYEEKLFCNECFLNLYRQRLLNPWLPVTNFTDYL
VDQFNLVQTNCSTTLPYSTSASTLYVGTATATTTTSVTTTGSSATTTPTCLGQMVQPLQNWLTCNDLCDTYNIST
GDARVATGDYACYFDEATCFPRPCEIDTVWDTPSCDGLATRYSNSTYTVTTAQLLSWNTNIQGSCSGIAAGQRVC
KSAPGGTFPKPNATITAPGATGEPTYYTAATAAYPTQSGTISECGNYYLVVAGDDCSTIDLRFGLNFSQLQEYNP
YLNSTCGNLWLNYDICVAPVTPETVSTDAQATAPRRKTAPVDLIMGARLVFPSSETAVVYTATAAMVPPIVVQGT
AILAVVTLIMAARPQMENVARILPETRPALVPSLGRAVPRLVIVEVPVTTVLGQTAIAVLVRRDVAQSIKEEFLS
VYTISK*
Coding >Pro_DTO377G3_2|g3363.t1
ATGTTATTCTCCTTCTTGAGACTCTGTTTTGTCCTGCTTACGGCATGGACAACTTGGGCTGCGGCCGATTTTGCG
CTGTACAAAAACTATGATGCAGACGCCTTGATTGCTGGGCTCTCTCTGAGCAGTACGTGTCTTGCAGCACTGAAC
ACCACCGTCTCTTGCAATGAAACCGCTATTAGCCTATTAGGACACGGGGCAGACATCCACTTCTGGACGACTGCT
GAGGTAGAGAACCTCTGCACGACAGACTGTGTCTCGTCCCTTAGTTTCTGGAAGGATAATGTTGCAACAGTCTGT
GCAGAAGAGACCACAATCCAGGGCAATGTCGTGGTCAAGGCGAGAGCGCTACCACTGACATTTACCTATAATTCC
GATCTTGTATGCATGAAGGACAGTTCATCAAATTGGTGTTTCCTGGTCTCTCAGACATGGCAAGGAAGTGACTAT
ATCCGTTGGGATCCAACAATGTGCTTCGCCGATGGTGATGACAACAGCACAGTCGCGCCTGAATGTGCCGATCCG
GATTTTGACGTCGGTGATATCAGTGATGACATGTCCGCTCTAACTAATATATATGAAGAGAAATTGTTCTGCAAT
GAGTGTTTCTTGAATCTGTATCGGCAACGTCTCCTGAATCCTTGGCTACCAGTTACCAATTTCACGGATTATTTA
GTCGATCAGTTCAACCTTGTTCAAACAAATTGCTCAACAACGCTGCCTTACAGCACTTCAGCCTCCACCTTATAC
GTAGGGACGGCAACGGCTACTACCACCACCAGCGTAACGACGACAGGTTCCTCCGCAACAACTACACCGACTTGT
CTGGGTCAAATGGTGCAGCCGCTGCAAAACTGGCTCACCTGCAATGATCTTTGCGATACGTACAATATATCAACA
GGTGACGCTAGAGTTGCCACTGGGGATTACGCTTGCTATTTCGACGAGGCTACCTGTTTCCCCCGTCCATGCGAG
ATCGATACGGTTTGGGATACACCAAGTTGTGACGGCCTTGCCACGAGATATTCCAACTCGACTTACACCGTGACC
ACTGCTCAATTGCTTAGCTGGAATACTAATATCCAGGGCAGTTGTTCAGGGATTGCAGCAGGACAGCGTGTATGT
AAAAGTGCTCCTGGAGGAACGTTTCCTAAACCCAACGCGACCATCACGGCGCCTGGTGCGACCGGCGAGCCTACT
TACTACACAGCAGCCACTGCGGCTTACCCGACCCAAAGTGGAACCATCAGCGAGTGCGGTAACTACTATCTCGTT
GTAGCCGGTGACGACTGTTCTACCATCGACCTGCGCTTCGGTCTGAACTTTAGCCAGTTGCAAGAGTATAACCCG
TACCTTAACTCCACCTGCGGCAACCTGTGGCTTAATTACGACATATGCGTCGCCCCTGTCACCCCTGAGACAGTC
TCAACGGACGCACAGGCAACGGCACCGCGACGCAAGACGGCACCTGTGGACCTGATTATGGGGGCACGACTTGTA
TTCCCAAGTTCGGAAACTGCTGTAGTATATACGGCTACTGCGGCAATGGTACCACCTATTGTGGTGCAGGGAACT
GCTATTCTGGCAGTTGTGACACTGATAATGGCGGCCCGTCCACAAATGGAGAATGTGGCCCGAATTTTGCCGGAA
ACAAGACCTGCACTGGTACCCAGTTTGGGACGTGCTGTTCCGCGTCTGGTTATTGTGGAAGTACCAGTGACTACT
GTTCTGGGTCAAACTGCTATAGCGGTGCTTGTACGTCGTGATGTTGCTCAGTCTATAAAAGAGGAGTTTCTCAGT
GTATATACCATTTCCAAGTAA
Transcript >Pro_DTO377G3_2|g3363.t1
ATGTTATTCTCCTTCTTGAGACTCTGTTTTGTCCTGCTTACGGCATGGACAACTTGGGCTGCGGCCGATTTTGCG
CTGTACAAAAACTATGATGCAGACGCCTTGATTGCTGGGCTCTCTCTGAGCAGTACGTGTCTTGCAGCACTGAAC
ACCACCGTCTCTTGCAATGAAACCGCTATTAGCCTATTAGGACACGGGGCAGACATCCACTTCTGGACGACTGCT
GAGGTAGAGAACCTCTGCACGACAGACTGTGTCTCGTCCCTTAGTTTCTGGAAGGATAATGTTGCAACAGTCTGT
GCAGAAGAGACCACAATCCAGGGCAATGTCGTGGTCAAGGCGAGAGCGCTACCACTGACATTTACCTATAATTCC
GATCTTGTATGCATGAAGGACAGTTCATCAAATTGGTGTTTCCTGGTCTCTCAGACATGGCAAGGAAGTGACTAT
ATCCGTTGGGATCCAACAATGTGCTTCGCCGATGGTGATGACAACAGCACAGTCGCGCCTGAATGTGCCGATCCG
GATTTTGACGTCGGTGATATCAGTGATGACATGTCCGCTCTAACTAATATATATGAAGAGAAATTGTTCTGCAAT
GAGTGTTTCTTGAATCTGTATCGGCAACGTCTCCTGAATCCTTGGCTACCAGTTACCAATTTCACGGATTATTTA
GTCGATCAGTTCAACCTTGTTCAAACAAATTGCTCAACAACGCTGCCTTACAGCACTTCAGCCTCCACCTTATAC
GTAGGGACGGCAACGGCTACTACCACCACCAGCGTAACGACGACAGGTTCCTCCGCAACAACTACACCGACTTGT
CTGGGTCAAATGGTGCAGCCGCTGCAAAACTGGCTCACCTGCAATGATCTTTGCGATACGTACAATATATCAACA
GGTGACGCTAGAGTTGCCACTGGGGATTACGCTTGCTATTTCGACGAGGCTACCTGTTTCCCCCGTCCATGCGAG
ATCGATACGGTTTGGGATACACCAAGTTGTGACGGCCTTGCCACGAGATATTCCAACTCGACTTACACCGTGACC
ACTGCTCAATTGCTTAGCTGGAATACTAATATCCAGGGCAGTTGTTCAGGGATTGCAGCAGGACAGCGTGTATGT
AAAAGTGCTCCTGGAGGAACGTTTCCTAAACCCAACGCGACCATCACGGCGCCTGGTGCGACCGGCGAGCCTACT
TACTACACAGCAGCCACTGCGGCTTACCCGACCCAAAGTGGAACCATCAGCGAGTGCGGTAACTACTATCTCGTT
GTAGCCGGTGACGACTGTTCTACCATCGACCTGCGCTTCGGTCTGAACTTTAGCCAGTTGCAAGAGTATAACCCG
TACCTTAACTCCACCTGCGGCAACCTGTGGCTTAATTACGACATATGCGTCGCCCCTGTCACCCCTGAGACAGTC
TCAACGGACGCACAGGCAACGGCACCGCGACGCAAGACGGCACCTGTGGACCTGATTATGGGGGCACGACTTGTA
TTCCCAAGTTCGGAAACTGCTGTAGTATATACGGCTACTGCGGCAATGGTACCACCTATTGTGGTGCAGGGAACT
GCTATTCTGGCAGTTGTGACACTGATAATGGCGGCCCGTCCACAAATGGAGAATGTGGCCCGAATTTTGCCGGAA
ACAAGACCTGCACTGGTACCCAGTTTGGGACGTGCTGTTCCGCGTCTGGTTATTGTGGAAGTACCAGTGACTACT
GTTCTGGGTCAAACTGCTATAGCGGTGCTTGTACGTCGTGATGTTGCTCAGTCTATAAAAGAGGAGTTTCTCAGT
GTATATACCATTTCCAAGTAA
Gene >Pro_DTO377G3_2|g3363.t1
ATGTTATTCTCCTTCTTGAGACTCTGTTTTGTCCTGCTTACGGCATGGACAACTTGGGCTGCGGCCGATTTTGCG
CTGTACAAAAACTATGATGCAGACGCCTTGATTGCTGGGCTCTCTCTGAGCAGTACGTGTCTTGCAGCACTGTGA
GTACTTGCCTCTGGTTCCGTCTCCCTGAAATGTCTTATCCCTTTAACACCTCACCAGGAACACCACCGTCTCTTG
CAATGAAACCGCTATTAGCCTATTAGGACACGGGGCAGACATCCACTGTAAGCTTGTTATGTCCAAACATGTTGT
TGTCTGCCAACGAAGAAGCGAAGCTAATAAATAAAGTCTGGACGACTGCTGAGGTAGAGAACCTCTGCACGACAG
ACTGTGTCTCGTCCCTTAGTTTCTGGAAGGATAATGTTGCAACAGTCTGTGCAGAAGAGACCACAATCCAGGGCA
ATGTCGTGGTCAAGGCGAGAGCGCTACCACTGACATTTACCTATAATTCCGATCTTGTATGCATGAAGGACAGTT
CATCAAATTGGTGTTTCCTGGTCTCTCAGACATGGCAAGGAAGTGACTATATCCGTTGGGATCCAACAATGTGCT
TCGCCGATGGTGATGACAACAGCACAGTCGCGCCTGAATGTGCCGATCCGGATTTTGACGTCGGTGATATCAGTG
ATGACATGTCCGCTCTAACTAATATATATGAAGAGAAATTGGTATGTGAACTCCCTATGAAGTACATCAGTGCCA
TCGAGGTTGTCTACTAACTGGGCGTAGTTCTGCAATGAGTGTTTCTTGAATCTGTATCGGCAACGTCTCCTGAAT
CCTTGGCTACCAGTTACCAATTTCACGGATTATTTAGTCGATCAGTTCAACCTTGTTCAAACAAATTGCTCAACA
ACGCTGCCTTACAGCACTTCAGCCTCCACCTTATACGTAGGGACGGCAACGGCTACTACCACCACCAGCGTAACG
ACGACAGGTTCCTCCGCAACAACTACACCGACTTGTCTGGGTCAAATGGTGCAGCCGCTGCAAAACTGGCTCACC
TGCAATGATCTTTGCGATACGTATGGATGGCATTCCCCCAATAGTTGGTGGGCTGGCTGATTTCTAATGCGCTGC
ATGCGGCAATTAGGTACAATATATCAACAGGTGACGCTAGAGTTGCCACTGGGGATTACGCTTGCTATTTCGACG
AGGCTACCTGTTTCCCCCGTCCATGCGAGATCGATACGGTTTGGGATACACCAAGTTGGTATGTAGGGCATAATG
GTTGCCTGAAGCCACGAGACCATAATCTGTGCTAAGTCCTCTGAAAATAGTGACGGCCTTGCCACGAGATATTCC
AACTCGACTTACACCGTGACCACTGCTCAATTGCTTAGCTGGAATACTAATATCCAGGGCAGTTGTTCAGGGATT
GCAGCAGGACAGCGTGTATGTAAAAGGTAAGTCTAAGATCAAGAAGGACACAATAGAGGCATTTGCGGCATTGAG
TGATGCTAACCAGACTCGGCGAGAAAAAAGTGCTCCTGGAGGAACGTTTCCTAAACCCAACGCGACCATCACGGC
GCCTGGTGCGACCGGCGAGCCTACTTACTACACAGCAGCCACTGCGGCTTACCCGACCCAAAGTGGAACCATCAG
CGAGTGCGGTAACTACTATCTCGTTGTAGCCGGTGACGACTGTTCTACCATCGACCTGCGCTTCGGTCTGAACTT
TAGCCAGTTGCAAGAGTATAACCCGTACCTTAACTCCACCTGCGGCAACCTGTGGCTTAATTACGACATATGCGT
CGCCCCTGTCACCCCTGAGACAGTCTCAACGGACGGTACGTGCCCTGCGGGGGTTACCTGTGTTGGAAGTGCCTT
TGGCGACTGCTGCTCGCCATTTGGCTACTGCGGAACCGGGTCAGATTACTGTATCAGCACAGGCAACGGCACCGC
GACGCAAGACGGCACCTGTGGACCTGATTATGGGGGCACGACTTGTATTCCCAAGTTCGGAAACTGCTGTAGTAT
ATACGTAAGTGATGCAGTATCCATTCATGACCATCCTTCCTATTCACTGCAGTCGCTGATAATAGACACAGGGCT
ACTGCGGCAATGGTACCACCTATTGTGGTGCAGGGAACTGCTATTCTGGCAGTTGTGACACTGATAATGGCGGCC
CGTCCACAAATGGAGAATGTGGCCCGAATTTTGCCGGAAACAAGACCTGCACTGGTACCCAGTTTGGGACGTGCT
GTTCCGCGTCTGGTTATTGTGGAAGTACCAGTGACTACTGTTCTGGGTCAAACTGCTATAGCGGTGCTTGTACGT
CGTGATGTTGCTCAGTCTATAAAAGAGGAGTTTCTCAGTGTATATACCATTTCCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail