Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3346.t1
Gene name
Locationscaffold_05:410265..411419
Strand-
Gene length (bp)1154
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03986 Autophagy_N Autophagocytosis associated protein (Atg3), N-terminal domain 5.8E-46 4 164
PF10381 Autophagy_C Autophagocytosis associated protein C-terminal 2.4E-15 335 359
PF03987 Autophagy_act_C Autophagocytosis associated protein, active-site domain 4.7E-13 191 253

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3346.t1
MNILHSTLSTWRDRLAPVSRTSTFRNTGQITPEEFVLAGDYLVYKFPTWSWADASSPAKRVSYLPDGKQFLVTRG
VPCHRRLNDNFAGDAGLEDEIVRDFLSGGDGEGTPDNGEDGWLRTGGGRDAGADHDKQEARIRDVRTVDESGNLG
EQEEEDDIPDMEDDDDDDEAIIRETDNHSGTQSLRTYTLYITYSNFYRTPRLYLSGYLSPSEPLPPHLMMEDIVG
DYKDKTVTLEDFPWFEGSVKMASVHPCRHASVMKTLLDRADAALKLRRDKLKQTQSREEANRVLRAGGGLEGLVD
ETNNLSLGDSNNGHPGGDEWEMLQHDEEEQVAIRVDQYLVVFLKFIASVTPGIEHDFTMGV*
Coding >Pro_DTO377G3_2|g3346.t1
ATGAATATCCTGCACTCTACATTGTCAACTTGGCGGGACCGCCTGGCCCCGGTATCGCGCACTTCTACCTTCCGT
AACACCGGCCAAATCACTCCCGAGGAGTTTGTTCTCGCCGGAGATTATCTAGTCTACAAGTTCCCCACATGGTCA
TGGGCCGACGCATCGAGTCCGGCAAAACGAGTCTCCTACCTCCCAGATGGCAAGCAGTTTCTGGTTACTCGTGGA
GTACCATGCCATCGGAGACTGAACGACAACTTTGCCGGGGATGCAGGACTCGAGGATGAGATTGTGAGGGATTTC
CTATCTGGCGGTGACGGCGAAGGCACACCGGATAATGGAGAGGATGGATGGTTGCGGACTGGCGGTGGGCGTGAT
GCTGGGGCAGATCATGATAAGCAAGAAGCTCGGATCCGCGACGTGCGAACCGTCGATGAATCCGGGAATCTGGGC
GAGCAGGAGGAGGAGGATGATATCCCCGATATGGAGGATGATGACGATGACGATGAAGCTATCATCCGAGAGACC
GATAATCATTCAGGGACACAATCTCTCCGCACGTACACCCTTTACATTACATACTCAAACTTCTACCGCACACCC
CGCCTCTACCTGTCCGGCTATTTGTCGCCATCCGAACCGCTTCCGCCACATCTGATGATGGAGGATATTGTCGGC
GACTACAAAGACAAGACCGTGACGCTAGAGGACTTCCCATGGTTCGAGGGCAGCGTCAAGATGGCCAGTGTACAC
CCATGCCGCCACGCCTCTGTGATGAAGACACTCTTGGATCGTGCCGATGCCGCACTCAAGCTTCGCCGTGACAAG
CTCAAACAGACGCAGTCGCGCGAGGAAGCGAACCGCGTTCTCCGGGCAGGCGGCGGGCTGGAGGGCTTGGTGGAT
GAGACCAACAACCTGTCGCTCGGGGACTCCAACAACGGACATCCTGGCGGGGATGAGTGGGAGATGCTGCAACAT
GACGAGGAAGAACAGGTCGCGATCCGTGTAGACCAGTACCTGGTTGTGTTCCTCAAGTTCATTGCCAGTGTGACG
CCGGGCATTGAGCACGACTTTACGATGGGGGTATAA
Transcript >Pro_DTO377G3_2|g3346.t1
ATGAATATCCTGCACTCTACATTGTCAACTTGGCGGGACCGCCTGGCCCCGGTATCGCGCACTTCTACCTTCCGT
AACACCGGCCAAATCACTCCCGAGGAGTTTGTTCTCGCCGGAGATTATCTAGTCTACAAGTTCCCCACATGGTCA
TGGGCCGACGCATCGAGTCCGGCAAAACGAGTCTCCTACCTCCCAGATGGCAAGCAGTTTCTGGTTACTCGTGGA
GTACCATGCCATCGGAGACTGAACGACAACTTTGCCGGGGATGCAGGACTCGAGGATGAGATTGTGAGGGATTTC
CTATCTGGCGGTGACGGCGAAGGCACACCGGATAATGGAGAGGATGGATGGTTGCGGACTGGCGGTGGGCGTGAT
GCTGGGGCAGATCATGATAAGCAAGAAGCTCGGATCCGCGACGTGCGAACCGTCGATGAATCCGGGAATCTGGGC
GAGCAGGAGGAGGAGGATGATATCCCCGATATGGAGGATGATGACGATGACGATGAAGCTATCATCCGAGAGACC
GATAATCATTCAGGGACACAATCTCTCCGCACGTACACCCTTTACATTACATACTCAAACTTCTACCGCACACCC
CGCCTCTACCTGTCCGGCTATTTGTCGCCATCCGAACCGCTTCCGCCACATCTGATGATGGAGGATATTGTCGGC
GACTACAAAGACAAGACCGTGACGCTAGAGGACTTCCCATGGTTCGAGGGCAGCGTCAAGATGGCCAGTGTACAC
CCATGCCGCCACGCCTCTGTGATGAAGACACTCTTGGATCGTGCCGATGCCGCACTCAAGCTTCGCCGTGACAAG
CTCAAACAGACGCAGTCGCGCGAGGAAGCGAACCGCGTTCTCCGGGCAGGCGGCGGGCTGGAGGGCTTGGTGGAT
GAGACCAACAACCTGTCGCTCGGGGACTCCAACAACGGACATCCTGGCGGGGATGAGTGGGAGATGCTGCAACAT
GACGAGGAAGAACAGGTCGCGATCCGTGTAGACCAGTACCTGGTTGTGTTCCTCAAGTTCATTGCCAGTGTGACG
CCGGGCATTGAGCACGACTTTACGATGGGGGTATAA
Gene >Pro_DTO377G3_2|g3346.t1
ATGAATATCCTGCACTCTACATTGTCAACTTGGCGGGACCGCCTGGCCCCGGTATCGCGCACTTCTACCTTCCGT
AACACCGGCCAAATCACTCCCGAGGAGTTTGTTCTCGCCGGAGATTATCTAGTCTACAAGTTCCCCACATGGTCA
TGGGCCGACGCATCGAGTCCGGCAAAACGAGTCTCCTACCTCCCAGATGGCAAGCAGTTTCTGGTTACTCGTGGA
GTACCATGCCATCGGAGACTGAACGACAACTTTGCCGGGGATGCAGGACTCGAGGATGAGATTGTGAGGGATTTC
CTATCTGGCGGTGACGGCGAAGGCACACCGGATAATGGAGAGGATGGATGGTTGCGGACTGGCGGTGGGCGTGAT
GCTGGGGCAGATCATGATAAGCAAGAAGCTCGGATCCGCGACGTGCGAACCGTCGATGAATCCGGGAATCTGGGC
GAGCAGGAGGAGGAGGATGATATCCCCGATATGGAGGATGATGACGATGACGATGAAGCTATCATCCGAGAGACC
GATAATCATTCAGGGACACAGTGAGTGCCATTTTCCTATCTGCAACATCACCTTTCTCTTTTCTAACCGTGACTT
GTTATCGCTCCAGATCTCTCCGCACGTACACCCTTTACATTACATACTCAAACTTCTACCGCACACCCCGCCTCT
ACCTGTCCGGCTATTTGTCGCCATCCGAACCGCTTCCGCCACATCTGATGATGGAGGATATTGTCGGCGACTACA
AAGACAAGACCGTGACGCTAGAGGACTTCCCATGGTTCGAGGGCAGCGTCAAGATGGCCAGTGTACACCCATGCC
GCCACGCCTCTGTGATGAAGACACTCTTGGATCGTGCCGATGCCGCACTCAAGCTTCGCCGTGACAAGCTCAAAC
AGACGCAGTCGCGCGAGGAAGCGAACCGCGTTCTCCGGGCAGGCGGCGGGCTGGAGGGCTTGGTGGATGAGACCA
ACAACCTGTCGCTCGGGGACTCCAACAACGGACATCCTGGCGGGGATGAGTGGGAGATGCTGCAACATGACGAGG
AAGAACAGGTCGCGATCCGTGTAGACCAGTACCTGGTTGTGTTCCTCAAGTTCATTGCCAGTGTGACGCCGGGCA
TTGAGCACGACTTTACGATGGGGGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail