Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3340.t1
Gene name
Locationscaffold_05:393186..394165
Strand-
Gene length (bp)979
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 4.7E-07 118 249

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 96.49 57.51 135.46
5d_25C Five days - 25 degrees Celsius 153.40 93.43 213.38
7d_25C Seven days - 25 degrees Celsius 163.74 100.07 227.42
10d_25C Ten days - 25 degrees Celsius 210.32 128.96 291.67
7d_15C Seven days - 15 degrees Celsius 202.38 122.00 282.76
7d_30C Seven days - 30 degrees Celsius 131.86 79.43 184.30

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.024657 yes
3d_25C 7d_25C 0.008133 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.161481 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.836224 no
5d_25C 7d_15C 0.237613 no
5d_25C 7d_30C 0.572797 no
5d_25C 10d_25C 0.156474 no
7d_25C 7d_15C 0.396188 no
7d_25C 7d_30C 0.372227 no
7d_25C 10d_25C 0.279463 no
7d_15C 7d_30C 0.041414 yes
7d_15C 10d_25C 0.907191 no
7d_30C 10d_25C 0.019090 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3340.t1
MSTFTLPGSNLNVNSIPDLSEKDLLSFPAFKTWITTLQHSLARQEHPSHKFHSDPYVLRKIDIQAVDRFGGGRLG
FVKLKADVSNSQGETLPGSVFLRGGSVGMLLILHPNDIPNPTEKDKRVILTIQPRIPAGSLSFAEIPAGMLDDSG
TFAGGAAKEIHEETGLRVEQGDLIDMTSLALQAAQEPGYGERLQAAVYPSPGGSDEFIPLFLCQKSMPVKEIEGL
QGKLTGLRESGEKITLKIIPLADLWKEGIRDGKTLAAWALYQGLKQERLL*
Coding >Pro_DTO377G3_2|g3340.t1
ATGTCAACATTCACACTTCCCGGCTCAAATCTGAACGTGAATAGCATCCCAGATCTAAGCGAGAAAGACCTCCTC
TCATTCCCAGCCTTCAAAACCTGGATAACAACCCTCCAGCACTCCCTCGCGCGACAAGAACACCCCTCACACAAG
TTCCACAGTGACCCATACGTACTGCGCAAAATCGACATTCAAGCCGTCGACCGCTTCGGTGGCGGGCGATTAGGC
TTCGTCAAATTGAAAGCGGATGTATCGAATAGCCAGGGCGAGACTCTGCCGGGTAGCGTATTTCTGCGGGGTGGC
AGTGTCGGCATGTTGCTCATCCTCCACCCAAATGATATACCAAACCCGACTGAAAAGGACAAGCGCGTTATCCTG
ACCATCCAGCCTCGCATTCCAGCGGGCTCGCTGTCGTTCGCGGAGATCCCGGCTGGGATGCTTGATGATAGTGGG
ACGTTTGCTGGCGGTGCGGCGAAGGAGATCCACGAAGAGACCGGGTTGCGGGTCGAGCAGGGCGATTTGATTGAT
ATGACCTCGCTGGCGCTGCAGGCTGCGCAGGAACCTGGCTACGGTGAGCGCCTGCAGGCTGCGGTTTATCCGTCT
CCTGGCGGGAGTGATGAGTTTATTCCTTTATTTTTGTGTCAGAAGTCTATGCCGGTAAAGGAGATTGAGGGGTTG
CAGGGGAAGTTGACGGGGTTGCGGGAATCCGGGGAGAAGATTACGCTTAAGATTATTCCTTTGGCGGATCTGTGG
AAGGAGGGGATTAGGGATGGGAAGACTCTGGCCGCTTGGGCTTTGTATCAGGGGTTGAAGCAGGAGCGATTGCTC
TGA
Transcript >Pro_DTO377G3_2|g3340.t1
ATGTCAACATTCACACTTCCCGGCTCAAATCTGAACGTGAATAGCATCCCAGATCTAAGCGAGAAAGACCTCCTC
TCATTCCCAGCCTTCAAAACCTGGATAACAACCCTCCAGCACTCCCTCGCGCGACAAGAACACCCCTCACACAAG
TTCCACAGTGACCCATACGTACTGCGCAAAATCGACATTCAAGCCGTCGACCGCTTCGGTGGCGGGCGATTAGGC
TTCGTCAAATTGAAAGCGGATGTATCGAATAGCCAGGGCGAGACTCTGCCGGGTAGCGTATTTCTGCGGGGTGGC
AGTGTCGGCATGTTGCTCATCCTCCACCCAAATGATATACCAAACCCGACTGAAAAGGACAAGCGCGTTATCCTG
ACCATCCAGCCTCGCATTCCAGCGGGCTCGCTGTCGTTCGCGGAGATCCCGGCTGGGATGCTTGATGATAGTGGG
ACGTTTGCTGGCGGTGCGGCGAAGGAGATCCACGAAGAGACCGGGTTGCGGGTCGAGCAGGGCGATTTGATTGAT
ATGACCTCGCTGGCGCTGCAGGCTGCGCAGGAACCTGGCTACGGTGAGCGCCTGCAGGCTGCGGTTTATCCGTCT
CCTGGCGGGAGTGATGAGTTTATTCCTTTATTTTTGTGTCAGAAGTCTATGCCGGTAAAGGAGATTGAGGGGTTG
CAGGGGAAGTTGACGGGGTTGCGGGAATCCGGGGAGAAGATTACGCTTAAGATTATTCCTTTGGCGGATCTGTGG
AAGGAGGGGATTAGGGATGGGAAGACTCTGGCCGCTTGGGCTTTGTATCAGGGGTTGAAGCAGGAGCGATTGCTC
TGA
Gene >Pro_DTO377G3_2|g3340.t1
ATGTCAACATTCACACTTCCCGGCTCAAATCTGAACGTGAATAGCATCCCAGATCTAAGCGAGAAAGACCTCCTC
TCATTCCCAGCCTTCAAAACCTGGATAACAACCCTCCAGCACTCCCTCGCGCGACAAGAACACCCCTCACACAAG
TTCCACAGTGACCCATACGTACTGCGCAAAATCGACATTCAAGCCGTCGACCGCTTCGGTGGCGGGCGATTAGGC
TTCGTCAAATTGAAAGCGGATGTATCGAATAGCCAGGGCGAGACTCTGCCGGGTAGCGTATTTCTGCGGGGTGGC
AGTGTCGGCATGTTGGTGAGTAAAGTTTTGTTCCATTTCTACTCGATAGGAGGTTTTTTCCTTGATACTCTATTT
TGTAGAGATCTAGAAAGAAAAAAAAAAAGAAAATATTACGCCCCAGCCCCACCATTCGAAAATATATGGTTTGTT
CTAATTCTATGTATAGCTCATCCTCCACCCAAATGATATACCAAACCCGACTGAAAAGGACAAGCGCGTTATCCT
GACCATCCAGCCTCGCATTCCAGCGGGCTCGCTGTCGTTCGCGGAGATCCCGGCTGGGATGCTTGATGATAGTGG
GACGTTTGCTGGCGGTGCGGCGAAGGAGATCCACGAAGAGACCGGGTTGCGGGTCGAGCAGGGCGATTTGATTGA
TATGACCTCGCTGGCGCTGCAGGCTGCGCAGGAACCTGGCTACGGTGAGCGCCTGCAGGCTGCGGTTTATCCGTC
TCCTGGCGGGAGTGATGAGTTTATTCCTTTATTTTTGTGTCAGAAGTCTATGCCGGTAAAGGAGATTGAGGGGTT
GCAGGGGAAGTTGACGGGGTTGCGGGAATCCGGGGAGAAGATTACGCTTAAGATTATTCCTTTGGCGGATCTGTG
GAAGGAGGGGATTAGGGATGGGAAGACTCTGGCCGCTTGGGCTTTGTATCAGGGGTTGAAGCAGGAGCGATTGCT
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail