Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3339.t1
Gene name
Locationscaffold_05:391867..393080
Strand+
Gene length (bp)1213
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 7.8E-18 76 199

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 92.92 53.35 132.49
5d_25C Five days - 25 degrees Celsius 111.50 65.39 157.60
7d_25C Seven days - 25 degrees Celsius 90.36 51.72 129.01
10d_25C Ten days - 25 degrees Celsius 103.08 59.73 146.43
7d_15C Seven days - 15 degrees Celsius 124.58 73.72 175.44
7d_30C Seven days - 30 degrees Celsius 101.11 58.09 144.14

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.501823 no
3d_25C 7d_25C 0.941446 no
3d_25C 7d_15C 0.235613 no
3d_25C 7d_30C 0.794959 no
3d_25C 10d_25C 0.736715 no
5d_25C 7d_25C 0.429367 no
5d_25C 7d_15C 0.710824 no
5d_25C 7d_30C 0.754706 no
5d_25C 10d_25C 0.804399 no
7d_25C 7d_15C 0.177500 no
7d_25C 7d_30C 0.714412 no
7d_25C 10d_25C 0.651196 no
7d_15C 7d_30C 0.422158 no
7d_15C 10d_25C 0.472904 no
7d_30C 10d_25C 0.957585 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3339.t1
MSARVQAKSKLISRGPLDPSEARWARMVKTTYTDPLGVERTWESAERTKRGLALVGLPSRLPGPQQTRPDGIDLD
GVGIVAILNKDSGSELLLQKQYRPPIDAVVIEVPAGLIDAGETPEQCAVRELKEETGYVGVAEQTSPVMFNDPGL
CNTNLHMVHVRVDMSLPENKNPKPELEDNEFIECFTIPLTSLFDELKKLEKEGYAIDARIGTLAEGIELAKKWKL
*
Coding >Pro_DTO377G3_2|g3339.t1
ATGTCAGCTCGCGTACAGGCCAAGTCGAAACTCATTTCGCGGGGACCATTGGACCCCAGCGAAGCCCGCTGGGCT
CGAATGGTGAAGACAACATACACCGACCCCCTGGGTGTCGAGCGAACATGGGAATCAGCTGAGCGCACGAAACGG
GGACTAGCATTAGTGGGGCTCCCCAGTCGACTCCCGGGACCTCAACAGACTCGTCCTGACGGGATTGATCTTGAT
GGCGTTGGGATCGTCGCTATTTTGAACAAGGATTCTGGCTCGGAGCTGCTTCTGCAGAAGCAATACCGCCCTCCC
ATTGATGCTGTTGTCATTGAGGTTCCTGCGGGGCTTATCGATGCGGGCGAGACGCCTGAGCAATGTGCTGTTCGA
GAACTTAAGGAGGAGACTGGTTATGTTGGCGTCGCGGAGCAGACTAGTCCGGTTATGTTTAACGACCCAGGGCTT
TGCAATACCAACCTGCATATGGTCCACGTCCGGGTTGATATGTCTCTTCCCGAGAACAAGAACCCGAAGCCTGAG
CTCGAGGATAACGAGTTCATTGAATGCTTTACTATTCCTTTGACATCGTTGTTCGACGAGTTAAAGAAGCTTGAA
AAAGAGGGTTATGCCATTGATGCCAGGATCGGAACCCTAGCCGAGGGCATTGAACTCGCAAAGAAATGGAAGTTG
TGA
Transcript >Pro_DTO377G3_2|g3339.t1
ATGTCAGCTCGCGTACAGGCCAAGTCGAAACTCATTTCGCGGGGACCATTGGACCCCAGCGAAGCCCGCTGGGCT
CGAATGGTGAAGACAACATACACCGACCCCCTGGGTGTCGAGCGAACATGGGAATCAGCTGAGCGCACGAAACGG
GGACTAGCATTAGTGGGGCTCCCCAGTCGACTCCCGGGACCTCAACAGACTCGTCCTGACGGGATTGATCTTGAT
GGCGTTGGGATCGTCGCTATTTTGAACAAGGATTCTGGCTCGGAGCTGCTTCTGCAGAAGCAATACCGCCCTCCC
ATTGATGCTGTTGTCATTGAGGTTCCTGCGGGGCTTATCGATGCGGGCGAGACGCCTGAGCAATGTGCTGTTCGA
GAACTTAAGGAGGAGACTGGTTATGTTGGCGTCGCGGAGCAGACTAGTCCGGTTATGTTTAACGACCCAGGGCTT
TGCAATACCAACCTGCATATGGTCCACGTCCGGGTTGATATGTCTCTTCCCGAGAACAAGAACCCGAAGCCTGAG
CTCGAGGATAACGAGTTCATTGAATGCTTTACTATTCCTTTGACATCGTTGTTCGACGAGTTAAAGAAGCTTGAA
AAAGAGGGTTATGCCATTGATGCCAGGATCGGAACCCTAGCCGAGGGCATTGAACTCGCAAAGAAATGGAAGTTG
TGA
Gene >Pro_DTO377G3_2|g3339.t1
ATGTCAGCTCGCGTACAGGCCAAGTCGAAACTCATTTCGCGGGGACCATTGGTACGTTTTTCTAATCTCCCTTGG
GTCTCTTCAGCGAATCCCAAGTCCATTATATAGACAGAGCGCGGAGGATATCACCAAAAAAGCGCCAATGCACGA
CTGACACGTCTCACCAAACAGGACCCCAGCGAAGCCCGCTGGGCTCGAATGGTGAAGACAACATACACCGACCCC
CTGGGTGTCGAGCGAACATGGGAATCAGCTGAGCGCACGGTAAGACCTATCCCTTGTTCTGTGCTTATTGTATTA
TGCGCGCTGTTGGTAGATGTCTGGGGTATATGTATGTATCGCACCTATCGCAGGTATCCACCTGTCTGCATGACT
GTCACGAAAGCCAAGCTACCCAACTAAGATCCGGCCTCATCTAAATCTAGAAACGGGGACTAGCATTAGTGGGGC
TCCCCAGTCGACTCCCGGGACCTCAACAGGTGGCATAAACCCGGGCGTTGCCTGGCGCTGTATCAACTAAAACCA
CATGACCGGTTGCCTTGCGATGTGTATCGGACCCATTGGTCACCATCTAACTCAAAAATCTATCAGAGCCTCCGT
TTGAAATTAGACTTCGGATTTGATGCTAACCGCGTTTTCCTAGACTCGTCCTGACGGGATTGATCTTGATGGCGT
TGGGATCGTCGCTATTTTGAACAAGGATTCTGGCTCGGAGCTGCTTCTGCAGAAGCAATACCGCCCTCCCATTGA
TGCTGTTGTCATTGAGGTTCCTGCGGGGCTTATCGATGCGGGCGAGACGCCTGAGCAATGTGCTGTTCGAGAACT
TAAGGAGGAGACTGGTTATGTTGGCGTCGCGGAGCAGACTAGTCCGGTTATGTTTAACGGTACGTGAGATTGCTA
TGGGATTTGTTTTGTTCTCGCGGGTTATTTTACTTCTTGTAAAGCTAAAGCTGACAAACATATGTGGTTATCAGA
CCCAGGGCTTTGCAATACCAACCTGCATATGGTCCACGTCCGGGTTGATATGTCTCTTCCCGAGAACAAGAACCC
GAAGCCTGAGCTCGAGGATAACGAGTTCATTGAATGCTTTACTATTCCTTTGACATCGTTGTTCGACGAGTTAAA
GAAGCTTGAAAAAGAGGGTTATGCCATTGATGCCAGGATCGGAACCCTAGCCGAGGGCATTGAACTCGCAAAGAA
ATGGAAGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail