Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3337.t1
Gene name
Locationscaffold_05:388330..389142
Strand+
Gene length (bp)812
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 5.0E-18 7 201
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 4.6E-06 7 196
PF13242 Hydrolase_like HAD-hyrolase-like 2.6E-05 158 215

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 37.89 18.05 57.72
5d_25C Five days - 25 degrees Celsius 29.78 12.64 46.91
7d_25C Seven days - 25 degrees Celsius 29.44 12.18 46.69
10d_25C Ten days - 25 degrees Celsius 14.81 4.25 25.37
7d_15C Seven days - 15 degrees Celsius 39.95 16.11 63.79
7d_30C Seven days - 30 degrees Celsius 107.82 58.20 157.43

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.483508 no
3d_25C 7d_25C 0.473234 no
3d_25C 7d_15C 0.905390 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.002761 yes
5d_25C 7d_25C 0.982839 no
5d_25C 7d_15C 0.395211 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.033697 yes
7d_25C 7d_15C 0.390418 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.040411 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.001804 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3337.t1
MTKITEIFFDCDNTLVLSEELAFEACADLANEILEANNIPDRYTGDQLIKDFVGQNFRGMLISLQQKYDFQIDED
KLEEYVIREEDQVIAKLNAKAKSCIGATEELEKVFAAKKYGLAVVSSSALRRVLASIRKVGQDKFFDENKVFSAA
SSLPKPTSKPDPAIYLYALEQVGKRASETVAIEDSKSGALSAVRAGIPVIAYVGSYNGEDTQKAMAKALTDIGAK
SVMYHWSEFEKCMKEIENDVSVDVQSTL*
Coding >Pro_DTO377G3_2|g3337.t1
ATGACTAAGATCACGGAAATCTTCTTCGATTGCGACAACACGCTGGTCCTCTCAGAGGAGCTAGCCTTCGAGGCT
TGTGCCGATCTGGCCAATGAGATCCTGGAGGCCAACAACATCCCCGACCGTTACACCGGCGACCAACTCATCAAA
GACTTTGTCGGCCAGAACTTCCGCGGCATGCTGATCTCTCTACAGCAGAAATATGACTTCCAGATCGACGAGGAC
AAGCTTGAAGAATACGTCATCAGAGAAGAGGACCAAGTCATTGCCAAGTTGAACGCCAAGGCTAAAAGCTGCATC
GGTGCCACCGAGGAGCTGGAAAAGGTTTTCGCCGCGAAGAAGTACGGTCTTGCCGTCGTCTCCTCGTCTGCGTTG
CGCCGCGTGCTCGCTTCCATCCGGAAGGTCGGTCAGGACAAGTTCTTTGACGAGAACAAGGTCTTCAGCGCCGCC
AGCTCCCTGCCAAAGCCGACCTCCAAGCCCGACCCCGCTATCTACCTGTATGCTCTCGAGCAGGTCGGCAAGCGT
GCTTCCGAGACTGTCGCCATCGAGGACAGCAAGTCTGGTGCTCTTTCTGCGGTTCGTGCCGGTATTCCCGTGATT
GCGTACGTTGGCAGCTACAATGGCGAAGATACGCAGAAGGCAATGGCGAAGGCCCTGACTGACATTGGCGCGAAG
AGCGTCATGTATCATTGGTCAGAGTTTGAGAAGTGTATGAAGGAAATCGAGAATGATGTCAGCGTCGATGTCCAG
TCGACCCTTTAA
Transcript >Pro_DTO377G3_2|g3337.t1
ATGACTAAGATCACGGAAATCTTCTTCGATTGCGACAACACGCTGGTCCTCTCAGAGGAGCTAGCCTTCGAGGCT
TGTGCCGATCTGGCCAATGAGATCCTGGAGGCCAACAACATCCCCGACCGTTACACCGGCGACCAACTCATCAAA
GACTTTGTCGGCCAGAACTTCCGCGGCATGCTGATCTCTCTACAGCAGAAATATGACTTCCAGATCGACGAGGAC
AAGCTTGAAGAATACGTCATCAGAGAAGAGGACCAAGTCATTGCCAAGTTGAACGCCAAGGCTAAAAGCTGCATC
GGTGCCACCGAGGAGCTGGAAAAGGTTTTCGCCGCGAAGAAGTACGGTCTTGCCGTCGTCTCCTCGTCTGCGTTG
CGCCGCGTGCTCGCTTCCATCCGGAAGGTCGGTCAGGACAAGTTCTTTGACGAGAACAAGGTCTTCAGCGCCGCC
AGCTCCCTGCCAAAGCCGACCTCCAAGCCCGACCCCGCTATCTACCTGTATGCTCTCGAGCAGGTCGGCAAGCGT
GCTTCCGAGACTGTCGCCATCGAGGACAGCAAGTCTGGTGCTCTTTCTGCGGTTCGTGCCGGTATTCCCGTGATT
GCGTACGTTGGCAGCTACAATGGCGAAGATACGCAGAAGGCAATGGCGAAGGCCCTGACTGACATTGGCGCGAAG
AGCGTCATGTATCATTGGTCAGAGTTTGAGAAGTGTATGAAGGAAATCGAGAATGATGTCAGCGTCGATGTCCAG
TCGACCCTTTAA
Gene >Pro_DTO377G3_2|g3337.t1
ATGACTAAGGTACGATCACGATCTATCCCATTAGAGACCCACACTAACGGGCACTGCAGATCACGGAAATCTTCT
TCGATTGCGACAACACGCTGGTCCTCTCAGAGGAGCTAGCCTTCGAGGCTTGTGCCGATCTGGCCAATGAGATCC
TGGAGGCCAACAACATCCCCGACCGTTACACCGGCGACCAACTCATCAAAGACTTTGTCGGCCAGAACTTCCGCG
GCATGCTGATCTCTCTACAGCAGAAATATGACTTCCAGATCGACGAGGACAAGCTTGAAGAATACGTCATCAGAG
AAGAGGACCAAGTCATTGCCAAGTTGAACGCCAAGGCTAAAAGCTGCATCGGTGCCACCGAGGAGCTGGAAAAGG
TTTTCGCCGCGAAGAAGTACGGTCTTGCCGTCGTCTCCTCGTCTGCGTTGCGCCGCGTGCTCGCTTCCATCCGGA
AGGTCGGTCAGGACAAGTTCTTTGACGAGAACAAGGTCTTCAGCGCCGCCAGCTCCCTGCCAAAGCCGACCTCCA
AGCCCGACCCCGCTATCTACCTGTATGCTCTCGAGCAGGTCGGCAAGCGTGCTTCCGAGACTGTCGCCATCGAGG
ACAGCAAGTCTGGTGCTCTTTCTGCGGTTCGTGCCGGTATTCCCGTGATTGCGTACGTTGGCAGCTACAATGGCG
AAGATACGCAGAAGGCAATGGCGAAGGCCCTGACTGACATTGGCGCGAAGAGCGTCATGTATCATTGGTCAGAGT
TTGAGAAGTGTATGAAGGAAATCGAGAATGATGTCAGCGTCGATGTCCAGTCGACCCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail