Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3328.t1
Gene name
Locationscaffold_05:363125..364069
Strand+
Gene length (bp)944
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03853 YjeF_N YjeF-related protein N-terminus 7.7E-35 27 190

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1690.29 922.57 2458.01
5d_25C Five days - 25 degrees Celsius 2036.74 1093.34 2980.14
7d_25C Seven days - 25 degrees Celsius 1650.97 879.84 2422.10
10d_25C Ten days - 25 degrees Celsius 2061.21 1101.61 3020.81
7d_15C Seven days - 15 degrees Celsius 2301.98 1157.86 3446.09
7d_30C Seven days - 30 degrees Celsius 1536.94 816.08 2257.81

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.542135 no
3d_25C 7d_25C 0.954338 no
3d_25C 7d_15C 0.266604 no
3d_25C 7d_30C 0.785036 no
3d_25C 10d_25C 0.505578 no
5d_25C 7d_25C 0.482707 no
5d_25C 7d_15C 0.724314 no
5d_25C 7d_30C 0.306777 no
5d_25C 10d_25C 0.977728 no
7d_25C 7d_15C 0.222685 no
7d_25C 7d_30C 0.842113 no
7d_25C 10d_25C 0.448036 no
7d_15C 7d_30C 0.123900 no
7d_15C 10d_25C 0.755441 no
7d_30C 10d_25C 0.282120 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3328.t1
MSLKAISAKDAASLDKDLMEVGGWSLDQLMELAGLSVAEAVWRVHPPSAGKKVLVVCGPGNNGGDGLVATRHLAQ
FGYTPSLYYPKQGKKELYERLKTQLHNLSVPFVDDFEPALKTADFLVDAIFGFSFGGPLRDPFDKIVSQIESANV
PVLSVDAPSSWDIQTGPPKEGPGAKFMPHALISLSAPKPCVAFYHGRHFIGGRFLTKNITDKYGLDLPKYQGVDQ
VLEIGVDAEGRL*
Coding >Pro_DTO377G3_2|g3328.t1
ATGTCGTTGAAGGCAATCTCAGCCAAAGATGCCGCATCACTTGACAAAGACCTCATGGAGGTCGGCGGCTGGTCT
CTGGACCAGTTGATGGAGCTAGCAGGCCTCTCTGTCGCGGAAGCCGTCTGGAGGGTCCACCCCCCAAGCGCAGGC
AAGAAAGTTCTAGTCGTCTGCGGACCAGGCAACAATGGCGGGGATGGTCTCGTAGCAACTCGCCACCTAGCCCAA
TTCGGCTACACCCCGTCTCTGTACTACCCAAAGCAGGGCAAAAAGGAGCTTTACGAACGCCTCAAAACCCAACTG
CATAACCTCTCAGTCCCCTTCGTTGACGACTTTGAACCAGCCCTGAAGACGGCAGACTTCCTGGTCGACGCCATC
TTCGGCTTCTCCTTCGGCGGACCATTGCGTGATCCATTCGACAAAATCGTCTCGCAAATCGAGTCCGCCAATGTC
CCGGTGCTGAGTGTCGATGCGCCCAGCTCATGGGATATCCAGACCGGACCACCGAAGGAAGGACCCGGTGCGAAG
TTCATGCCGCATGCGTTGATCAGTTTGTCTGCACCTAAGCCGTGCGTGGCATTTTATCACGGCAGGCATTTTATC
GGTGGTAGGTTTTTGACGAAGAACATTACTGATAAGTATGGGCTTGATTTGCCCAAGTATCAGGGCGTTGATCAG
GTTTTGGAGATTGGGGTTGATGCGGAGGGCAGATTGTAA
Transcript >Pro_DTO377G3_2|g3328.t1
ATGTCGTTGAAGGCAATCTCAGCCAAAGATGCCGCATCACTTGACAAAGACCTCATGGAGGTCGGCGGCTGGTCT
CTGGACCAGTTGATGGAGCTAGCAGGCCTCTCTGTCGCGGAAGCCGTCTGGAGGGTCCACCCCCCAAGCGCAGGC
AAGAAAGTTCTAGTCGTCTGCGGACCAGGCAACAATGGCGGGGATGGTCTCGTAGCAACTCGCCACCTAGCCCAA
TTCGGCTACACCCCGTCTCTGTACTACCCAAAGCAGGGCAAAAAGGAGCTTTACGAACGCCTCAAAACCCAACTG
CATAACCTCTCAGTCCCCTTCGTTGACGACTTTGAACCAGCCCTGAAGACGGCAGACTTCCTGGTCGACGCCATC
TTCGGCTTCTCCTTCGGCGGACCATTGCGTGATCCATTCGACAAAATCGTCTCGCAAATCGAGTCCGCCAATGTC
CCGGTGCTGAGTGTCGATGCGCCCAGCTCATGGGATATCCAGACCGGACCACCGAAGGAAGGACCCGGTGCGAAG
TTCATGCCGCATGCGTTGATCAGTTTGTCTGCACCTAAGCCGTGCGTGGCATTTTATCACGGCAGGCATTTTATC
GGTGGTAGGTTTTTGACGAAGAACATTACTGATAAGTATGGGCTTGATTTGCCCAAGTATCAGGGCGTTGATCAG
GTTTTGGAGATTGGGGTTGATGCGGAGGGCAGATTGTAA
Gene >Pro_DTO377G3_2|g3328.t1
ATGTCGTTGAAGGTATAGTTGTCTGATATTAGCTCCATCTCAAAACCTAACCATGTTCCTAGGCAATCTCAGCCA
AAGATGCCGCATCACTTGACAAAGACCTCATGGAGGTCGGCGGCTGGTCTCTGGACCAGTTGATGGAGCTAGCAG
GCCTCTCTGTCGCGGAAGCCGGTCAGAACCATCAATCTCGAGCATGTAGTCGGGCCATACTGATACAAGCAACTA
GTCTGGAGGGTCCACCCCCCAAGCGCAGGCAAGAAAGTTCTAGTCGTCTGCGGACCAGGCAACAATGGTGAGAAG
CATCTCCAACCTTGCCATTCGAGCAACAGCAACCTAACAAACCACCAGGCGGGGATGGTCTCGTAGCAACTCGCC
ACCTAGCCCAATTCGGCTACACCCCGTCTCTGTACTACCCAAAGCAGGGCAAAAAGGAGCTTTACGAAGTACGCA
ATCCCAAACCAGAAGGATCGTAGAAGCAAAAAAAAAAAAGAAGAAAATCTAACCCAAGCCAGCGCCTCAAAACCC
AACTGCATAACCTCTCAGTCCCCTTCGTTGACGACTTTGAACCAGCCCTGAAGACGGCAGACTTCCTGGTCGACG
CCATCTTCGGCTTCTCCTTCGGCGGACCATTGCGTGATCCATTCGACAAAATCGTCTCGCAAATCGAGTCCGCCA
ATGTCCCGGTGCTGAGTGTCGATGCGCCCAGCTCATGGGATATCCAGACCGGACCACCGAAGGAAGGACCCGGTG
CGAAGTTCATGCCGCATGCGTTGATCAGTTTGTCTGCACCTAAGCCGTGCGTGGCATTTTATCACGGCAGGCATT
TTATCGGTGGTAGGTTTTTGACGAAGAACATTACTGATAAGTATGGGCTTGATTTGCCCAAGTATCAGGGCGTTG
ATCAGGTTTTGGAGATTGGGGTTGATGCGGAGGGCAGATTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail