Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3319.t1
Gene name
Locationscaffold_05:335937..337788
Strand-
Gene length (bp)1851
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00682 HMGL-like HMGL-like 6.5E-44 5 280
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 1.7E-43 340 587
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 1.7E-22 342 513

GO

GO Term Description Terminal node
GO:0003860 3-hydroxyisobutyryl-CoA hydrolase activity Yes
GO:0003824 catalytic activity Yes
GO:0016289 CoA hydrolase activity No
GO:0016790 thiolester hydrolase activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3319.t1
MGPAVRIVEVGPRDGLQNIRDTIPTSIKLELIQRLQKTGLQAIELTSVVSPKAIPQLADCRQVLRNPDIKRLLDS
SQLRLPVLVPNAKGLEIAIQHGVREIAVFISSTEGFSKANINCTVAQGIERATQVASLAIRSQIAARGYVSCIFA
DPYDGPTPLPAVLRCVKALLDAGCYEVSLGDTLGVGSPSNVRELINYLTSNGIPPEKLAGHFHDTYGQAVANAWE
AFNSGIRVFDSSVAGLGGCPFAPGAKGNVASEDLVYMFHNAGISTGIDLPKLVETGVWISKQLLKNNSSRAGTAL
ATKLQLAAPSTQSKPRAPGLKWDLCNETQGLQIYRSGVNLKIVLNRPKNGNTLTATMISDLTSVISNASSDPLTS
RIVITANGKFFCTGMDLGKGSTAVGEGGSSSDAQFTGLTRLFEAIDQCPKVTIAAVNGPAFGGGVGLAFSCDIRT
FTQGANVTLSEVKLGLCAATISKYVIRELGVAFAREVMLSARAVTPGELKGLGIISEIASDQENLRVRVDELLIR
LKAASPNASRMSKELVRLAWAHGGGDAQAAGIKGLFKEMMRSDADGAYGVKEFQAKRKVDWDAYVLGPKPKL*
Coding >Pro_DTO377G3_2|g3319.t1
ATGGGTCCGGCTGTTCGAATCGTCGAAGTCGGCCCACGGGACGGCCTTCAGAACATCCGAGACACAATACCTACT
TCAATTAAGTTGGAATTGATTCAACGGCTCCAGAAGACAGGACTACAAGCTATTGAGCTGACGTCAGTCGTCTCA
CCGAAAGCCATTCCTCAACTGGCGGATTGTCGTCAGGTCTTGCGTAACCCGGACATCAAGAGACTCTTGGATAGC
TCGCAACTTCGGCTTCCTGTTTTGGTTCCCAATGCTAAGGGACTCGAGATTGCCATACAGCACGGCGTTCGAGAG
ATTGCTGTGTTCATCAGTTCTACAGAGGGATTTAGTAAAGCCAATATCAACTGCACTGTTGCGCAGGGAATTGAA
CGGGCTACCCAAGTGGCATCCCTGGCTATACGTTCTCAAATCGCTGCGAGAGGCTATGTGTCCTGCATTTTCGCT
GATCCGTATGACGGTCCAACTCCATTACCAGCAGTCCTCCGCTGTGTAAAGGCCCTCCTAGATGCCGGCTGCTAC
GAGGTTAGCCTCGGGGATACCCTAGGCGTTGGCTCTCCTTCAAACGTGCGCGAGCTCATCAACTACCTGACCAGC
AACGGTATCCCGCCAGAGAAGCTAGCAGGCCACTTCCACGACACTTATGGACAAGCCGTAGCAAACGCGTGGGAG
GCCTTCAATAGCGGAATCCGAGTGTTCGACAGCAGTGTCGCCGGTCTGGGTGGATGTCCATTTGCACCAGGAGCA
AAAGGAAATGTCGCCTCCGAGGATCTGGTTTACATGTTCCACAATGCGGGTATTTCAACAGGCATCGATCTCCCA
AAGCTAGTCGAAACGGGTGTATGGATATCGAAACAACTTCTGAAGAACAACTCAAGTCGAGCCGGAACGGCTCTG
GCAACCAAATTACAGCTGGCAGCCCCAAGCACACAATCCAAACCAAGAGCTCCCGGCCTCAAATGGGACCTTTGC
AACGAAACACAGGGTTTACAGATCTACCGATCAGGCGTGAACTTGAAAATCGTCCTCAACAGGCCCAAGAACGGA
AACACCCTGACAGCAACCATGATCTCGGATTTGACATCGGTGATCTCAAATGCCAGTTCTGATCCCTTAACCTCC
CGAATCGTCATTACAGCCAATGGAAAATTCTTTTGCACGGGAATGGACCTCGGCAAGGGAAGCACAGCCGTTGGA
GAAGGCGGATCGAGCAGCGACGCACAATTCACGGGTTTAACGCGACTCTTCGAGGCAATTGATCAATGTCCTAAA
GTCACCATTGCGGCGGTGAATGGGCCTGCGTTTGGTGGTGGAGTTGGTTTAGCTTTCTCGTGTGATATACGGACA
TTTACACAAGGAGCGAATGTCACGCTGAGCGAGGTGAAGCTAGGACTTTGTGCGGCAACGATATCCAAATATGTT
ATTCGAGAATTGGGGGTTGCATTTGCACGAGAGGTGATGCTTTCTGCGAGAGCGGTTACTCCTGGTGAGTTGAAG
GGGTTGGGAATTATTTCTGAGATTGCCTCGGACCAGGAGAATCTGCGGGTTAGAGTTGATGAGCTTTTGATTCGC
CTTAAAGCTGCTTCGCCTAATGCTTCGCGGATGTCGAAGGAATTGGTTCGACTTGCCTGGGCGCATGGAGGAGGT
GATGCACAAGCTGCTGGGATTAAAGGGCTATTTAAAGAGATGATGCGGTCTGATGCAGATGGAGCATATGGCGTG
AAGGAATTCCAGGCGAAGAGGAAGGTAGATTGGGATGCCTATGTTCTAGGGCCGAAGCCCAAGCTGTAA
Transcript >Pro_DTO377G3_2|g3319.t1
ATGGGTCCGGCTGTTCGAATCGTCGAAGTCGGCCCACGGGACGGCCTTCAGAACATCCGAGACACAATACCTACT
TCAATTAAGTTGGAATTGATTCAACGGCTCCAGAAGACAGGACTACAAGCTATTGAGCTGACGTCAGTCGTCTCA
CCGAAAGCCATTCCTCAACTGGCGGATTGTCGTCAGGTCTTGCGTAACCCGGACATCAAGAGACTCTTGGATAGC
TCGCAACTTCGGCTTCCTGTTTTGGTTCCCAATGCTAAGGGACTCGAGATTGCCATACAGCACGGCGTTCGAGAG
ATTGCTGTGTTCATCAGTTCTACAGAGGGATTTAGTAAAGCCAATATCAACTGCACTGTTGCGCAGGGAATTGAA
CGGGCTACCCAAGTGGCATCCCTGGCTATACGTTCTCAAATCGCTGCGAGAGGCTATGTGTCCTGCATTTTCGCT
GATCCGTATGACGGTCCAACTCCATTACCAGCAGTCCTCCGCTGTGTAAAGGCCCTCCTAGATGCCGGCTGCTAC
GAGGTTAGCCTCGGGGATACCCTAGGCGTTGGCTCTCCTTCAAACGTGCGCGAGCTCATCAACTACCTGACCAGC
AACGGTATCCCGCCAGAGAAGCTAGCAGGCCACTTCCACGACACTTATGGACAAGCCGTAGCAAACGCGTGGGAG
GCCTTCAATAGCGGAATCCGAGTGTTCGACAGCAGTGTCGCCGGTCTGGGTGGATGTCCATTTGCACCAGGAGCA
AAAGGAAATGTCGCCTCCGAGGATCTGGTTTACATGTTCCACAATGCGGGTATTTCAACAGGCATCGATCTCCCA
AAGCTAGTCGAAACGGGTGTATGGATATCGAAACAACTTCTGAAGAACAACTCAAGTCGAGCCGGAACGGCTCTG
GCAACCAAATTACAGCTGGCAGCCCCAAGCACACAATCCAAACCAAGAGCTCCCGGCCTCAAATGGGACCTTTGC
AACGAAACACAGGGTTTACAGATCTACCGATCAGGCGTGAACTTGAAAATCGTCCTCAACAGGCCCAAGAACGGA
AACACCCTGACAGCAACCATGATCTCGGATTTGACATCGGTGATCTCAAATGCCAGTTCTGATCCCTTAACCTCC
CGAATCGTCATTACAGCCAATGGAAAATTCTTTTGCACGGGAATGGACCTCGGCAAGGGAAGCACAGCCGTTGGA
GAAGGCGGATCGAGCAGCGACGCACAATTCACGGGTTTAACGCGACTCTTCGAGGCAATTGATCAATGTCCTAAA
GTCACCATTGCGGCGGTGAATGGGCCTGCGTTTGGTGGTGGAGTTGGTTTAGCTTTCTCGTGTGATATACGGACA
TTTACACAAGGAGCGAATGTCACGCTGAGCGAGGTGAAGCTAGGACTTTGTGCGGCAACGATATCCAAATATGTT
ATTCGAGAATTGGGGGTTGCATTTGCACGAGAGGTGATGCTTTCTGCGAGAGCGGTTACTCCTGGTGAGTTGAAG
GGGTTGGGAATTATTTCTGAGATTGCCTCGGACCAGGAGAATCTGCGGGTTAGAGTTGATGAGCTTTTGATTCGC
CTTAAAGCTGCTTCGCCTAATGCTTCGCGGATGTCGAAGGAATTGGTTCGACTTGCCTGGGCGCATGGAGGAGGT
GATGCACAAGCTGCTGGGATTAAAGGGCTATTTAAAGAGATGATGCGGTCTGATGCAGATGGAGCATATGGCGTG
AAGGAATTCCAGGCGAAGAGGAAGGTAGATTGGGATGCCTATGTTCTAGGGCCGAAGCCCAAGCTGTAA
Gene >Pro_DTO377G3_2|g3319.t1
ATGGGTCCGGCTGTTCGAATCGTCGAAGTCGGCCCACGGGACGGCCTTCAGAACATCCGAGACACAATACCTACT
TCAATTAAGTTGGAATTGATTCAACGGCTCCAGAAGACAGGACTACAAGCTATTGAGCTGACGTCAGTCGTCTCA
CCGAAAGCCATTCCTCAACTGGCGGATTGTCGTCAGGTCTTGCGTAACCCGGACATCAAGAGACTCTTGGATAGC
TCGCAACTTCGGCTTCCTGTTTTGGTTCCCAATGCTAAGGGACTCGAGATTGCCATACAGCACGGCGTTCGAGAG
ATTGCTGTGTTCATCAGTTCTACAGAGGGATTTAGTAAAGCCAATATCAACTGCACTGTTGCGCAGGGAATTGAA
CGGGCTACCCAAGTGGCATCCCTGGCTATACGTTCTCAAATCGCTGCGAGAGGGTAAGAAAATGGGTCCATTCCC
TTATATCACAATCCAATGGCAACTAACCTAAACAGCTATGTGTCCTGCATTTTCGCTGATCCGTATGACGGTCCA
ACTCCATTACCAGCAGTCCTCCGCTGTGTAAAGGCCCTCCTAGATGCCGGCTGCTACGAGGTTAGCCTCGGGGAT
ACCCTAGGCGTTGGCTCTCCTTCAAACGTGCGCGAGCTCATCAACTACCTGACCAGCAACGGTATCCCGCCAGAG
AAGCTAGCAGGCCACTTCCACGACACTTATGGACAAGCCGTAGCAAACGCGTGGGAGGCCTTCAATAGCGGAATC
CGAGTGTTCGACAGCAGTGTCGCCGGTCTGGGTGGATGTCCATTTGCACCAGGAGCAAAAGGAAATGTCGCCTCC
GAGGATCTGGTTTACATGTTCCACAATGCGGGTATTTCAACAGGCATCGATCTCCCAAAGCTAGTCGAAACGGGT
GTATGGATATCGAAACAACTTCTGAAGAACAACTCAAGTCGAGCCGGAACGGCTCTGGCAACCAAATTACAGCTG
GCAGCCCCAAGCACACAATCCAAACCAAGAGCTCCCGGCCTCAAATGGGACCTTTGCAACGAAACACAGGGTTTA
CAGATCTACCGATCAGGCGTGAACTTGAAAATCGTCCTCAACAGGCCCAAGAACGGAAACACCCTGACAGCAACC
ATGATCTCGGATTTGACATCGGTGATCTCAAATGCCAGTTCTGATCCCTTAACCTCCCGAATCGTCATTACAGCC
AATGGAAAATTCTTTTGCACGGGAATGGACCTCGGCAAGGGAAGCACAGCCGTTGGAGAAGGCGGATCGAGCAGC
GACGCACAATTCACGGGTTTAACGCGACTCTTCGAGGCAATTGATCAATGTCCTAAAGTCACCATTGCGGCGGTG
AATGGGCCTGCGTTTGGTGGTGGAGTTGGTTTAGCTTTCTCGTGTGATATACGGACATTTACACAAGGAGCGAAT
GTCACGCTGAGCGAGGTGAAGCTAGGACTTTGTGCGGCAACGATATCCAAATATGTTATTCGAGAATTGGGGGTT
GCATTTGCACGAGAGGTGATGCTTTCTGCGAGAGCGGTTACTCCTGGTGAGTTGAAGGGGTTGGGAATTATTTCT
GAGATTGCCTCGGACCAGGAGAATCTGCGGGTTAGAGTTGATGAGCTTTTGATTCGCCTTAAAGCTGCTTCGCCT
AATGCTTCGCGGATGTCGAAGGAATTGGTTCGACTTGCCTGGGCGCATGGAGGAGGTGATGCACAAGCTGCTGGG
ATTAAAGGGCTATTTAAAGAGATGATGCGGTCTGATGCAGATGGAGCATATGGCGTGAAGGAATTCCAGGCGAAG
AGGAAGGTAGATTGGGATGCCTATGTTCTAGGGCCGAAGCCCAAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail