Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3314.t1
Gene name
Locationscaffold_05:324894..327367
Strand+
Gene length (bp)2473
Transcript length (bp)2409
Coding sequence length (bp)2409
Protein length (aa) 803

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 8.9E-69 152 361
PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain 1.6E-41 36 146
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 2.1E-30 377 487
PF00364 Biotin_lipoyl Biotin-requiring enzyme 2.4E-11 736 801
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 4.4E-09 178 330
PF02222 ATP-grasp ATP-grasp domain 1.1E-07 177 331
PF02655 ATP-grasp_3 ATP-grasp domain 3.2E-06 150 333

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0005524 ATP binding Yes
GO:0097367 carbohydrate derivative binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0016881 acid-amino acid ligase activity No
GO:0030554 adenyl nucleotide binding No
GO:0016874 ligase activity No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3314.t1
MAVTFTQDPKGTDVSVLRKPLFVAEPPLGKDGRPIIRKVLIANRGEIACRIIQTCRKLNITSVAVYVDEDASSLH
VRDADEAINIGSIDRSARNPFLDIELLVQTALSTCAQAIHPGYGYLSENADFAQRVHDAGLIFIGPSPSAMSTLG
DKRSSKDYLRAHAPEVPLIPGFSGSSQDAEALGRVATEIGFPVMLKASAGGGGKGMRIVREAGQLKVELERAQSE
ARRSFGSDDCILEKFIESSKHVEIQIMGDSHGHVVSFLDRDCSVQRRHQKVIEETPCAFLTEATRKKMSETAVRV
AKLIGYENAGTVEFVVDIKTNQFYFLEVNARLQVEHPITEEVTGVDLVSLQLFVAAGGSLRSLPTLGNVTQNGHA
IECRLCAENPEREFFPEHGKIHLWLPASGPLAPGRDIRYETAIQTGSSVSIYFDSMIAKLVVWAPTRALAIEKMA
QVLGQTACVGVKTNQLFMRSCLLNPAFRDPSYTTAFIPSHLNELLQPPSVQGLPEFKTIASILPSLVVRRLPDYA
TALSRPKPLRNVRMQFRNQRFDPVNIHCDVTTTVNWPSQTGQEVDSAPENAVMCIWKASPAGVSSGVEDVYLFPI
PNGKTTTDEEVSAAAEISAQYNEISQALRTGKATSSPAYQVQVISWVPAHGNPALPDSWLTSTIEISVNGSKLTA
HVAIPSTRAHAFAGQVDCGQRIYCHFPSIGTHVEFKRDTLLSFAESNRSAAKANKGSEQKTVAAPMPCKVLSVLK
KNGDEVKSGDSVMVIESMKMEVNISVAASGKFQTDWKTGDAVEEGKILCSIV*
Coding >Pro_DTO377G3_2|g3314.t1
ATGGCTGTTACTTTCACCCAAGATCCGAAGGGCACTGATGTGTCAGTTCTTCGCAAGCCATTATTTGTCGCAGAG
CCACCCTTGGGCAAAGATGGAAGACCTATTATACGAAAAGTCTTGATTGCCAACCGCGGGGAAATCGCCTGTCGC
ATTATCCAGACATGCCGGAAATTGAATATCACATCCGTGGCGGTCTATGTCGACGAAGATGCATCTTCCCTCCAT
GTCCGTGACGCAGATGAAGCCATCAACATTGGCAGCATTGACCGCAGTGCTCGCAACCCGTTTCTTGACATCGAA
CTACTAGTTCAAACAGCTCTTTCAACGTGTGCTCAAGCTATCCACCCGGGATATGGCTATCTCAGCGAAAACGCA
GATTTTGCCCAGCGCGTCCATGACGCAGGTCTCATCTTCATCGGCCCCAGCCCCAGCGCCATGTCTACTCTCGGC
GACAAACGGTCATCAAAGGATTATCTGCGCGCTCATGCCCCTGAGGTCCCCCTAATCCCTGGATTCTCGGGATCC
AGCCAAGATGCCGAGGCTTTGGGTAGAGTGGCTACGGAGATTGGATTCCCGGTCATGCTCAAGGCTTCCGCTGGT
GGCGGTGGAAAGGGTATGCGGATTGTCCGCGAGGCGGGACAGCTTAAGGTTGAACTGGAAAGAGCTCAATCCGAG
GCTCGTCGGTCATTTGGTTCAGATGATTGTATCTTGGAGAAATTCATTGAGAGCAGCAAACATGTTGAGATTCAG
ATCATGGGTGACTCGCATGGACATGTGGTTTCATTTTTGGATAGGGATTGCTCTGTGCAACGAAGGCATCAGAAG
GTCATTGAAGAAACCCCGTGTGCTTTCCTCACAGAAGCAACTCGAAAAAAGATGAGTGAAACTGCTGTCCGGGTA
GCCAAGCTTATTGGATATGAAAATGCTGGTACGGTGGAGTTTGTGGTCGATATCAAGACGAACCAATTCTACTTC
CTAGAAGTCAATGCGCGGCTACAAGTTGAGCATCCGATCACAGAAGAAGTCACAGGGGTTGATCTTGTTTCTTTA
CAACTGTTCGTTGCAGCTGGAGGCAGCCTGAGAAGCCTTCCAACACTGGGGAATGTCACCCAGAATGGACATGCA
ATCGAGTGCCGGCTGTGTGCTGAGAACCCCGAGAGGGAATTCTTCCCAGAACATGGCAAAATTCACCTCTGGCTA
CCAGCAAGTGGGCCTTTAGCCCCGGGCCGCGATATCCGCTATGAAACAGCAATCCAAACGGGATCATCAGTATCT
ATCTATTTCGACTCAATGATCGCCAAGCTTGTCGTTTGGGCTCCAACAAGAGCGCTTGCTATTGAGAAAATGGCT
CAGGTTCTTGGGCAGACCGCTTGCGTTGGAGTCAAGACAAATCAACTTTTCATGCGATCATGTTTATTGAACCCG
GCGTTCCGTGATCCTAGCTATACAACTGCGTTCATTCCATCTCACCTGAATGAGCTTCTTCAGCCTCCTTCGGTC
CAGGGACTGCCTGAGTTCAAAACCATCGCCTCAATTCTTCCAAGCTTGGTAGTCCGACGACTTCCAGATTACGCC
ACAGCCTTGTCACGACCCAAACCTCTCCGGAATGTCCGCATGCAATTCCGAAACCAAAGGTTCGACCCAGTCAAT
ATCCATTGTGATGTTACAACTACGGTCAATTGGCCTAGCCAGACTGGACAGGAGGTTGATTCGGCACCTGAAAAC
GCTGTGATGTGCATTTGGAAAGCAAGCCCAGCCGGGGTTTCATCCGGCGTTGAGGATGTATATCTCTTCCCAATC
CCCAATGGAAAGACCACCACCGATGAAGAGGTGTCAGCAGCAGCAGAAATCTCCGCTCAATATAATGAAATCAGT
CAAGCACTACGCACCGGCAAAGCAACGTCTTCTCCGGCATACCAAGTCCAAGTTATCTCATGGGTCCCTGCACAC
GGCAACCCAGCTCTACCCGATTCCTGGCTTACATCCACCATTGAGATTTCAGTGAATGGATCAAAGCTCACTGCT
CATGTAGCTATCCCTTCAACACGGGCCCATGCCTTCGCGGGACAGGTCGATTGTGGTCAACGGATTTATTGTCAT
TTCCCCTCTATCGGAACTCATGTTGAATTCAAACGCGATACTCTGCTCTCATTTGCGGAGAGTAATCGATCAGCT
GCAAAGGCAAATAAGGGTTCAGAGCAAAAGACTGTTGCAGCTCCCATGCCGTGCAAAGTTCTTTCAGTCTTGAAA
AAGAATGGAGACGAAGTCAAGTCTGGCGATTCGGTTATGGTTATTGAGAGTATGAAGATGGAAGTCAATATTTCA
GTCGCGGCTTCAGGGAAGTTTCAAACAGATTGGAAGACCGGGGATGCGGTGGAGGAAGGAAAGATTCTTTGTTCG
ATTGTTTAG
Transcript >Pro_DTO377G3_2|g3314.t1
ATGGCTGTTACTTTCACCCAAGATCCGAAGGGCACTGATGTGTCAGTTCTTCGCAAGCCATTATTTGTCGCAGAG
CCACCCTTGGGCAAAGATGGAAGACCTATTATACGAAAAGTCTTGATTGCCAACCGCGGGGAAATCGCCTGTCGC
ATTATCCAGACATGCCGGAAATTGAATATCACATCCGTGGCGGTCTATGTCGACGAAGATGCATCTTCCCTCCAT
GTCCGTGACGCAGATGAAGCCATCAACATTGGCAGCATTGACCGCAGTGCTCGCAACCCGTTTCTTGACATCGAA
CTACTAGTTCAAACAGCTCTTTCAACGTGTGCTCAAGCTATCCACCCGGGATATGGCTATCTCAGCGAAAACGCA
GATTTTGCCCAGCGCGTCCATGACGCAGGTCTCATCTTCATCGGCCCCAGCCCCAGCGCCATGTCTACTCTCGGC
GACAAACGGTCATCAAAGGATTATCTGCGCGCTCATGCCCCTGAGGTCCCCCTAATCCCTGGATTCTCGGGATCC
AGCCAAGATGCCGAGGCTTTGGGTAGAGTGGCTACGGAGATTGGATTCCCGGTCATGCTCAAGGCTTCCGCTGGT
GGCGGTGGAAAGGGTATGCGGATTGTCCGCGAGGCGGGACAGCTTAAGGTTGAACTGGAAAGAGCTCAATCCGAG
GCTCGTCGGTCATTTGGTTCAGATGATTGTATCTTGGAGAAATTCATTGAGAGCAGCAAACATGTTGAGATTCAG
ATCATGGGTGACTCGCATGGACATGTGGTTTCATTTTTGGATAGGGATTGCTCTGTGCAACGAAGGCATCAGAAG
GTCATTGAAGAAACCCCGTGTGCTTTCCTCACAGAAGCAACTCGAAAAAAGATGAGTGAAACTGCTGTCCGGGTA
GCCAAGCTTATTGGATATGAAAATGCTGGTACGGTGGAGTTTGTGGTCGATATCAAGACGAACCAATTCTACTTC
CTAGAAGTCAATGCGCGGCTACAAGTTGAGCATCCGATCACAGAAGAAGTCACAGGGGTTGATCTTGTTTCTTTA
CAACTGTTCGTTGCAGCTGGAGGCAGCCTGAGAAGCCTTCCAACACTGGGGAATGTCACCCAGAATGGACATGCA
ATCGAGTGCCGGCTGTGTGCTGAGAACCCCGAGAGGGAATTCTTCCCAGAACATGGCAAAATTCACCTCTGGCTA
CCAGCAAGTGGGCCTTTAGCCCCGGGCCGCGATATCCGCTATGAAACAGCAATCCAAACGGGATCATCAGTATCT
ATCTATTTCGACTCAATGATCGCCAAGCTTGTCGTTTGGGCTCCAACAAGAGCGCTTGCTATTGAGAAAATGGCT
CAGGTTCTTGGGCAGACCGCTTGCGTTGGAGTCAAGACAAATCAACTTTTCATGCGATCATGTTTATTGAACCCG
GCGTTCCGTGATCCTAGCTATACAACTGCGTTCATTCCATCTCACCTGAATGAGCTTCTTCAGCCTCCTTCGGTC
CAGGGACTGCCTGAGTTCAAAACCATCGCCTCAATTCTTCCAAGCTTGGTAGTCCGACGACTTCCAGATTACGCC
ACAGCCTTGTCACGACCCAAACCTCTCCGGAATGTCCGCATGCAATTCCGAAACCAAAGGTTCGACCCAGTCAAT
ATCCATTGTGATGTTACAACTACGGTCAATTGGCCTAGCCAGACTGGACAGGAGGTTGATTCGGCACCTGAAAAC
GCTGTGATGTGCATTTGGAAAGCAAGCCCAGCCGGGGTTTCATCCGGCGTTGAGGATGTATATCTCTTCCCAATC
CCCAATGGAAAGACCACCACCGATGAAGAGGTGTCAGCAGCAGCAGAAATCTCCGCTCAATATAATGAAATCAGT
CAAGCACTACGCACCGGCAAAGCAACGTCTTCTCCGGCATACCAAGTCCAAGTTATCTCATGGGTCCCTGCACAC
GGCAACCCAGCTCTACCCGATTCCTGGCTTACATCCACCATTGAGATTTCAGTGAATGGATCAAAGCTCACTGCT
CATGTAGCTATCCCTTCAACACGGGCCCATGCCTTCGCGGGACAGGTCGATTGTGGTCAACGGATTTATTGTCAT
TTCCCCTCTATCGGAACTCATGTTGAATTCAAACGCGATACTCTGCTCTCATTTGCGGAGAGTAATCGATCAGCT
GCAAAGGCAAATAAGGGTTCAGAGCAAAAGACTGTTGCAGCTCCCATGCCGTGCAAAGTTCTTTCAGTCTTGAAA
AAGAATGGAGACGAAGTCAAGTCTGGCGATTCGGTTATGGTTATTGAGAGTATGAAGATGGAAGTCAATATTTCA
GTCGCGGCTTCAGGGAAGTTTCAAACAGATTGGAAGACCGGGGATGCGGTGGAGGAAGGAAAGATTCTTTGTTCG
ATTGTTTAG
Gene >Pro_DTO377G3_2|g3314.t1
ATGGCTGTTACTTTCACCCAAGATCCGAAGGGCACTGATGTGTCAGTTCTTCGCAAGCCATTATTTGTCGCAGAG
CCACCCTTGGGCAAAGATGGAAGACCTATTATACGAAAAGTCTTGATTGCCAACCGCGGGGAAATCGCCTGTCGC
ATTATCCAGACATGCCGGAAATTGAATATCACATCCGTGGCGGTCTATGTCGACGAGTGAGTGCTCAGAAATTGT
GCTACCAACATATCATCGAGGACAATCGCTAAAATGAGTACCCAGAGATGCATCTTCCCTCCATGTCCGTGACGC
AGATGAAGCCATCAACATTGGCAGCATTGACCGCAGTGCTCGCAACCCGTTTCTTGACATCGAACTACTAGTTCA
AACAGCTCTTTCAACGTGTGCTCAAGCTATCCACCCGGGATATGGCTATCTCAGCGAAAACGCAGATTTTGCCCA
GCGCGTCCATGACGCAGGTCTCATCTTCATCGGCCCCAGCCCCAGCGCCATGTCTACTCTCGGCGACAAACGGTC
ATCAAAGGATTATCTGCGCGCTCATGCCCCTGAGGTCCCCCTAATCCCTGGATTCTCGGGATCCAGCCAAGATGC
CGAGGCTTTGGGTAGAGTGGCTACGGAGATTGGATTCCCGGTCATGCTCAAGGCTTCCGCTGGTGGCGGTGGAAA
GGGTATGCGGATTGTCCGCGAGGCGGGACAGCTTAAGGTTGAACTGGAAAGAGCTCAATCCGAGGCTCGTCGGTC
ATTTGGTTCAGATGATTGTATCTTGGAGAAATTCATTGAGAGCAGCAAACATGTTGAGATTCAGATCATGGGTGA
CTCGCATGGACATGTGGTTTCATTTTTGGATAGGGATTGCTCTGTGCAACGAAGGCATCAGAAGGTCATTGAAGA
AACCCCGTGTGCTTTCCTCACAGAAGCAACTCGAAAAAAGATGAGTGAAACTGCTGTCCGGGTAGCCAAGCTTAT
TGGATATGAAAATGCTGGTACGGTGGAGTTTGTGGTCGATATCAAGACGAACCAATTCTACTTCCTAGAAGTCAA
TGCGCGGCTACAAGTTGAGCATCCGATCACAGAAGAAGTCACAGGGGTTGATCTTGTTTCTTTACAACTGTTCGT
TGCAGCTGGAGGCAGCCTGAGAAGCCTTCCAACACTGGGGAATGTCACCCAGAATGGACATGCAATCGAGTGCCG
GCTGTGTGCTGAGAACCCCGAGAGGGAATTCTTCCCAGAACATGGCAAAATTCACCTCTGGCTACCAGCAAGTGG
GCCTTTAGCCCCGGGCCGCGATATCCGCTATGAAACAGCAATCCAAACGGGATCATCAGTATCTATCTATTTCGA
CTCAATGATCGCCAAGCTTGTCGTTTGGGCTCCAACAAGAGCGCTTGCTATTGAGAAAATGGCTCAGGTTCTTGG
GCAGACCGCTTGCGTTGGAGTCAAGACAAATCAACTTTTCATGCGATCATGTTTATTGAACCCGGCGTTCCGTGA
TCCTAGCTATACAACTGCGTTCATTCCATCTCACCTGAATGAGCTTCTTCAGCCTCCTTCGGTCCAGGGACTGCC
TGAGTTCAAAACCATCGCCTCAATTCTTCCAAGCTTGGTAGTCCGACGACTTCCAGATTACGCCACAGCCTTGTC
ACGACCCAAACCTCTCCGGAATGTCCGCATGCAATTCCGAAACCAAAGGTTCGACCCAGTCAATATCCATTGTGA
TGTTACAACTACGGTCAATTGGCCTAGCCAGACTGGACAGGAGGTTGATTCGGCACCTGAAAACGCTGTGATGTG
CATTTGGAAAGCAAGCCCAGCCGGGGTTTCATCCGGCGTTGAGGATGTATATCTCTTCCCAATCCCCAATGGAAA
GACCACCACCGATGAAGAGGTGTCAGCAGCAGCAGAAATCTCCGCTCAATATAATGAAATCAGTCAAGCACTACG
CACCGGCAAAGCAACGTCTTCTCCGGCATACCAAGTCCAAGTTATCTCATGGGTCCCTGCACACGGCAACCCAGC
TCTACCCGATTCCTGGCTTACATCCACCATTGAGATTTCAGTGAATGGATCAAAGCTCACTGCTCATGTAGCTAT
CCCTTCAACACGGGCCCATGCCTTCGCGGGACAGGTCGATTGTGGTCAACGGATTTATTGTCATTTCCCCTCTAT
CGGAACTCATGTTGAATTCAAACGCGATACTCTGCTCTCATTTGCGGAGAGTAATCGATCAGCTGCAAAGGCAAA
TAAGGGTTCAGAGCAAAAGACTGTTGCAGCTCCCATGCCGTGCAAAGTTCTTTCAGTCTTGAAAAAGAATGGAGA
CGAAGTCAAGTCTGGCGATTCGGTTATGGTTATTGAGAGTATGAAGATGGAAGTCAATATTTCAGTCGCGGCTTC
AGGGAAGTTTCAAACAGATTGGAAGACCGGGGATGCGGTGGAGGAAGGAAAGATTCTTTGTTCGATTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail