Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3310.t1
Gene name
Locationscaffold_05:314958..315868
Strand-
Gene length (bp)910
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01184 Gpr1_Fun34_YaaH GPR1/FUN34/yaaH family 2.2E-25 46 208

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 79 101 22
3 103 125 22
4 150 172 22
5 179 201 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3310.t1
MSSDPDANDNVDMIEHVRTNASIAIPLEVFERRYLSLNIPNANWYKRLGNPTPLGLVGFLMAASPFACALLGWGG
AGGGGVATIGFSYFFGGVLQLIAAVLEFILGSTFPSVVFGSFGAFWVALGATQTPNFNAQAFFENGENGVDMSEY
YASFAFGLIFLAVLVSIYTICATRLNIVFFCLFFTLTFSVICLAASYWCMAQGKALAGERLTKVFASRKRPEIP*
Coding >Pro_DTO377G3_2|g3310.t1
ATGAGCAGTGACCCAGACGCGAATGACAACGTCGACATGATCGAGCATGTCCGCACGAATGCCAGCATCGCCATT
CCTCTTGAGGTTTTTGAGAGGCGATACCTTAGCCTCAATATTCCAAATGCAAACTGGTATAAGCGTCTCGGTAAC
CCAACACCTCTCGGACTTGTTGGATTTTTAATGGCAGCGAGCCCTTTCGCATGTGCTCTCTTGGGCTGGGGCGGA
GCAGGAGGCGGAGGTGTTGCGACTATAGGATTCTCGTATTTCTTTGGCGGCGTACTTCAACTTATCGCGGCAGTT
CTCGAGTTTATCCTGGGAAGCACTTTTCCTTCCGTCGTATTTGGCTCTTTTGGGGCATTCTGGGTGGCTCTCGGC
GCCACACAAACCCCTAATTTCAACGCCCAGGCTTTTTTCGAAAATGGTGAAAATGGTGTGGATATGAGCGAATAT
TACGCTAGCTTTGCATTTGGGCTGATCTTCCTGGCTGTCCTCGTTTCCATATACACGATTTGCGCAACCCGCCTT
AACATCGTCTTTTTTTGTCTTTTTTTCACCCTCACCTTTTCTGTGATATGTCTTGCCGCGTCATACTGGTGTATG
GCACAGGGGAAGGCTTTAGCTGGAGAACGGCTGACAAAGGTATTTGCATCCCGAAAGAGACCCGAGATTCCTTGA
Transcript >Pro_DTO377G3_2|g3310.t1
ATGAGCAGTGACCCAGACGCGAATGACAACGTCGACATGATCGAGCATGTCCGCACGAATGCCAGCATCGCCATT
CCTCTTGAGGTTTTTGAGAGGCGATACCTTAGCCTCAATATTCCAAATGCAAACTGGTATAAGCGTCTCGGTAAC
CCAACACCTCTCGGACTTGTTGGATTTTTAATGGCAGCGAGCCCTTTCGCATGTGCTCTCTTGGGCTGGGGCGGA
GCAGGAGGCGGAGGTGTTGCGACTATAGGATTCTCGTATTTCTTTGGCGGCGTACTTCAACTTATCGCGGCAGTT
CTCGAGTTTATCCTGGGAAGCACTTTTCCTTCCGTCGTATTTGGCTCTTTTGGGGCATTCTGGGTGGCTCTCGGC
GCCACACAAACCCCTAATTTCAACGCCCAGGCTTTTTTCGAAAATGGTGAAAATGGTGTGGATATGAGCGAATAT
TACGCTAGCTTTGCATTTGGGCTGATCTTCCTGGCTGTCCTCGTTTCCATATACACGATTTGCGCAACCCGCCTT
AACATCGTCTTTTTTTGTCTTTTTTTCACCCTCACCTTTTCTGTGATATGTCTTGCCGCGTCATACTGGTGTATG
GCACAGGGGAAGGCTTTAGCTGGAGAACGGCTGACAAAGGTATTTGCATCCCGAAAGAGACCCGAGATTCCTTGA
Gene >Pro_DTO377G3_2|g3310.t1
ATGAGCAGTGACCCAGACGCGAATGACAACGTCGACATGATCGAGCATGTCCGCACGAATGCCAGCATCGCCATT
CCTCTTGAGGTTTTTGAGAGGCGATACCTTAGCCTCAATATTCCAAATGCAAACTGGTATAAGCGTCTCGGTAAC
CCAACACCTCTGTGAGTTTTGGGGTCTCTGATTGTTTTTTCTCGAGCTCCTATCTGATAGTGATATAGCGGACTT
GTTGGATTTTTAATGGCAGCGAGCCCTTTCGCATGTGCTCTCTTGGGCTGGGGCGGAGCAGGAGGCGGAGGTGTT
GCGACTATGTAAGCGAGACCAAAGAGTGAATTCCTGATGATTATTTCAATCTGACTGGCTCTAACAGAGGATTCT
CGTATTTCTTTGGCGGCGTACTTCAACTTATCGCGGCAGTTCTCGAGTTTATCCTGGGAAGCACTTTTCCTTCCG
TCGTATTTGGCTCTTTTGGTAAGTTACACGGAGATCATCACAGAGGTACTTGAAAAAAATTGACATGTCATTATC
AGGGGCATTCTGGGTGGCTCTCGGCGCCACACAAACCCCTAATTTCAACGCCCAGGCTTTTTTCGAAAATGGTGA
AAATGGTGTGGATATGAGCGAATATTACGCTAGCTTTGGTAGGTGTTACCCAGTGGAATGGACGGTAGGTCGAAT
TGACCATGGCTAATTTACTCCAGCATTTGGGCTGATCTTCCTGGCTGTCCTCGTTTCCATATACACGATTTGCGC
AACCCGCCTTAACATCGTCTTTTTTTGTCTTTTTTTCACCCTCACCTTTTCTGTGATATGTCTTGCCGCGTCATA
CTGGTGTATGGCACAGGGGAAGGCTTTAGCTGGAGAACGGCTGACAAAGGTATTTGCATCCCGAAAGAGACCCGA
GATTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail