Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g331.t1
Gene name
Locationscaffold_01:838944..839896
Strand+
Gene length (bp)952
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14880 COX14 Cytochrome oxidase c assembly 4.4E-19 80 137

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

Domain # Start End Length
1 96 118 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 77.96 44.99 110.93
5d_25C Five days - 25 degrees Celsius 76.80 43.89 109.72
7d_25C Seven days - 25 degrees Celsius 89.44 51.84 127.03
10d_25C Ten days - 25 degrees Celsius 90.43 53.00 127.86
7d_15C Seven days - 15 degrees Celsius 66.20 36.97 95.43
7d_30C Seven days - 30 degrees Celsius 80.00 46.09 113.91

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.970109 no
3d_25C 7d_25C 0.639409 no
3d_25C 7d_15C 0.576305 no
3d_25C 7d_30C 0.945569 no
3d_25C 10d_25C 0.599037 no
5d_25C 7d_25C 0.605476 no
5d_25C 7d_15C 0.627861 no
5d_25C 7d_30C 0.909550 no
5d_25C 10d_25C 0.566477 no
7d_25C 7d_15C 0.237237 no
7d_25C 7d_30C 0.717790 no
7d_25C 10d_25C 0.976742 no
7d_15C 7d_30C 0.497125 no
7d_15C 10d_25C 0.201552 no
7d_30C 10d_25C 0.679046 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g331.t1
MSRSAADATRFTATGPYAHSKTGGANQASDFGKKKSSVKSSPKQLGPNGQPETPKEKVERLRAQARAARKTQAAG
SSADRWIESGRKFANKAHKGMVYSLIAASGVCGVLTVYSMISLTLYNRRQRTLWIEKELKTLKDAEIAYANGTAT
TEQQELLKKEKIGEIMKQKREEEKAQKPWAKAKRFLFEKLNMEDSGANPAPTSASALAIEGADKGQGSVMEAVQA
KQALDSAAAKTGAPLPGQLDVLAENVGQAAKSKTSSWTSWLTGR*
Coding >Pro_DTO377G3_2|g331.t1
ATGTCCCGATCCGCCGCAGACGCAACGCGGTTCACGGCCACCGGGCCCTACGCCCACTCCAAGACCGGCGGCGCG
AACCAGGCCTCAGACTTTGGGAAGAAGAAGTCCAGCGTGAAGTCATCACCAAAGCAACTTGGCCCGAATGGCCAA
CCGGAGACACCCAAGGAGAAGGTGGAACGACTGCGAGCACAGGCACGGGCTGCTCGGAAGACACAGGCAGCTGGA
AGCAGTGCGGACCGATGGATTGAGTCTGGGCGGAAGTTTGCCAATAAAGCACACAAGGGAATGGTTTACTCATTG
ATTGCCGCGTCCGGTGTCTGCGGTGTTCTTACAGTCTACTCAATGATTTCGCTTACGCTCTATAACCGCCGCCAA
CGCACGCTTTGGATCGAAAAGGAACTCAAGACCCTTAAGGATGCCGAGATCGCCTACGCCAACGGTACCGCAACC
ACCGAGCAGCAAGAGCTCCTGAAGAAGGAGAAGATCGGTGAAATTATGAAGCAGAAGCGCGAGGAGGAGAAGGCA
CAGAAGCCCTGGGCCAAGGCGAAGCGATTCCTCTTCGAGAAGCTAAACATGGAAGACAGCGGTGCCAATCCTGCA
CCAACATCCGCGTCAGCCTTGGCTATCGAGGGTGCCGACAAGGGCCAAGGTAGTGTTATGGAGGCCGTGCAGGCC
AAGCAAGCTCTCGATAGTGCTGCGGCGAAGACTGGCGCTCCTTTGCCCGGTCAGTTGGATGTGCTGGCTGAGAAT
GTGGGACAGGCTGCGAAGAGCAAGACATCAAGCTGGACTAGCTGGTTGACGGGGCGATAG
Transcript >Pro_DTO377G3_2|g331.t1
ATGTCCCGATCCGCCGCAGACGCAACGCGGTTCACGGCCACCGGGCCCTACGCCCACTCCAAGACCGGCGGCGCG
AACCAGGCCTCAGACTTTGGGAAGAAGAAGTCCAGCGTGAAGTCATCACCAAAGCAACTTGGCCCGAATGGCCAA
CCGGAGACACCCAAGGAGAAGGTGGAACGACTGCGAGCACAGGCACGGGCTGCTCGGAAGACACAGGCAGCTGGA
AGCAGTGCGGACCGATGGATTGAGTCTGGGCGGAAGTTTGCCAATAAAGCACACAAGGGAATGGTTTACTCATTG
ATTGCCGCGTCCGGTGTCTGCGGTGTTCTTACAGTCTACTCAATGATTTCGCTTACGCTCTATAACCGCCGCCAA
CGCACGCTTTGGATCGAAAAGGAACTCAAGACCCTTAAGGATGCCGAGATCGCCTACGCCAACGGTACCGCAACC
ACCGAGCAGCAAGAGCTCCTGAAGAAGGAGAAGATCGGTGAAATTATGAAGCAGAAGCGCGAGGAGGAGAAGGCA
CAGAAGCCCTGGGCCAAGGCGAAGCGATTCCTCTTCGAGAAGCTAAACATGGAAGACAGCGGTGCCAATCCTGCA
CCAACATCCGCGTCAGCCTTGGCTATCGAGGGTGCCGACAAGGGCCAAGGTAGTGTTATGGAGGCCGTGCAGGCC
AAGCAAGCTCTCGATAGTGCTGCGGCGAAGACTGGCGCTCCTTTGCCCGGTCAGTTGGATGTGCTGGCTGAGAAT
GTGGGACAGGCTGCGAAGAGCAAGACATCAAGCTGGACTAGCTGGTTGACGGGGCGATAG
Gene >Pro_DTO377G3_2|g331.t1
ATGTCCCGATCCGCCGCAGACGCAACGCGGTTCACGGCCACCGGGCCCTACGCCCACTCCAAGACCGGCGGCGCG
AACCAGGCCTCAGACTTTGGGAAGAAGAAGTCCAGCGTGAAGTCATCACCAAAGCAACTTGGCCCGAATGGCCAA
CCGGAGACACCCAAGGAGAAGGTGGAACGACTGCGAGCACAGGCACGGGCTGCTCGGAAGACACAGGCAGCTGGA
AGCAGTGCGGACCGATGGATTGAGTCTGGGCGGAAGTTTGCCAATAAAGCACACAAGGGAATGGTTTACTCATTG
ATTGCCGCGTCCGGTACGTTTCCTGCCCTGTGGGATATGAGCAAAATACTAGCAACACAACATACGATCCTCCGA
AGTCCGAGTCAGCAATGACAAGCAACGGACCCCCAGTTGATCCCTACTGGACTTATACTAATCCTTCTATGTTAT
AATAGGTGTCTGCGGTGTTCTTACAGTCTACTCAATGATTTCGCTTACGCTCTATAACCGCCGCCAACGCACGCT
TTGGATCGAAAAGGAACTCAAGACCCTTAAGGATGCCGAGATCGCCTACGCCAACGGTACCGCAACCACCGAGCA
GCAAGAGCTCCTGAAGAAGGAGAAGATCGGTGAAATTATGAAGCAGAAGCGCGAGGAGGAGAAGGCACAGAAGCC
CTGGGCCAAGGCGAAGCGATTCCTCTTCGAGAAGCTAAACATGGAAGACAGCGGTGCCAATCCTGCACCAACATC
CGCGTCAGCCTTGGCTATCGAGGGTGCCGACAAGGGCCAAGGTAGTGTTATGGAGGCCGTGCAGGCCAAGCAAGC
TCTCGATAGTGCTGCGGCGAAGACTGGCGCTCCTTTGCCCGGTCAGTTGGATGTGCTGGCTGAGAATGTGGGACA
GGCTGCGAAGAGCAAGACATCAAGCTGGACTAGCTGGTTGACGGGGCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail