Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3297.t1
Gene name
Locationscaffold_05:259564..263196
Strand+
Gene length (bp)3632
Transcript length (bp)3519
Coding sequence length (bp)3519
Protein length (aa) 1173

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 1.3E-43 653 842
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.1E-22 863 1075
PF00403 HMA Heavy-metal-associated domain 2.2E-05 374 430

GO

GO Term Description Terminal node
GO:0030001 metal ion transport Yes
GO:0046872 metal ion binding Yes
GO:0006812 cation transport No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0006810 transport No
GO:0051179 localization No
GO:0006811 ion transport No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 522 544 22
2 549 571 22
3 586 608 22
4 772 794 22
5 814 836 22
6 1122 1144 22
7 1149 1171 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3297.t1
MGRSCCERTPSQADAIDKAELKKSNSSSNCCGSSSETSSQEKSYRNGAIRKNDKTDDNNANATSAAQRDDPVYKD
PIDPCKGAALPGACEEGCCDQSASAAGNFTAKSKILSSSVSSGHPHTHTGSGTPWSSEHATSVEPIVAECCQDKP
SPCCDEACLDRLALRECHTGSDIPCMEAAGYSLSSTSTPTEGATLQGRACNRHHRSVREQYAARLTALGCICRAL
LALGKESCCEPRKRSSLGKGRSSERPLKQSVSCVSVESCCASSKSSSQSPLRSTDHGGKYKPARVTKTRASQGCS
TNSCCKPKITTCGNNFTDPCISESDKSEIKPADGSCADICCTSEKPSLPNDEKGGAVRIAPDLEGQAIGVEHVVL
SISGMTCTGCETKLNRTLAIMSGVGNLRTSLVLSRAEFDLDLSISTVELVIKHLERTTEFKCEIIASNGSAMDII
VSGDPGLIVNQAWPQGVSDISLVGNCTIRVSFDPEVVGARDLIEKHWGDIASLAPISGDPTLAAGSKHVRHSGFM
TLLSAVLTIPVLIMAWAPISERKIAYSSASLALATIIQVVIAGPFYPKALKALVFSRVIEMDLLIVLSTSVAYIF
SVVSFGFLVASRPLSTGQFFETSTLLVTLIMFGRYVATLARQKAVESISIRSLQAQTALLVDESPSIDAREIDVR
LLQYGDRFKVLPDMRIPTDGTVVSGSSEVNESMLTGESRHVEKKPKSRVIAGTINGSASLIVRLTRLPGDNAINT
IAAMVDEAKLSKPKIQELADKVASYFVPVIVGLTIATFVIWVALGISIQAKTRSEATVQAVTYAITVLIVSCPCA
IGLAVPMVVVICSGIAAERGVIFKSAHSIEVAYRASHVVLDKTGTLTQGKLSVVVESYLGDEESCLSLLLGLIGD
SKHPVSVAVGNHIRHKGIVATAVPDVKSLTGRGVEAKLGSQTLQAGNSRWLKTSTHPLVQPVLTKGYTVFCFTIN
GVLLAVFGLEDSLRADAPHVVNTLQRRGVTVHVVSGDDEGAVQNVATNLAIPESNIRARSSPADKQVYIKDLLGS
LSGGKEPIVIFCGDGTNDAVALAQATVGVHINEGSDVAQSAADVVLMRPYLSGLLTMMDASKVSMRRIKFNFVWS
FVYNTFAVLLAAGAFVNVRIPPEFAGLGELISVLPVIIAAVLLRWSI*
Coding >Pro_DTO377G3_2|g3297.t1
ATGGGACGCTCTTGCTGTGAAAGGACGCCCTCTCAAGCGGATGCGATTGATAAAGCTGAGTTGAAGAAATCGAAT
AGTTCATCGAATTGTTGTGGCAGTTCATCGGAGACTTCAAGTCAAGAGAAGTCTTATAGGAACGGCGCTATCCGA
AAGAACGACAAAACAGATGATAATAATGCCAATGCAACTTCCGCTGCCCAGCGTGATGACCCCGTATACAAGGAC
CCTATTGATCCTTGTAAGGGTGCAGCTCTGCCTGGGGCTTGCGAGGAAGGCTGCTGCGACCAGTCTGCCTCGGCT
GCTGGAAATTTTACCGCCAAATCTAAAATTTTAAGCTCTAGTGTTTCTTCGGGCCACCCTCACACACACACCGGC
TCCGGTACCCCATGGTCGAGTGAACATGCTACTTCCGTTGAACCTATTGTGGCAGAGTGCTGCCAAGACAAGCCT
TCGCCATGCTGTGATGAAGCCTGCCTTGATCGTCTGGCTTTACGTGAGTGTCATACGGGGTCAGATATACCATGC
ATGGAAGCAGCTGGTTACTCTCTTTCCTCGACATCCACACCGACAGAAGGTGCAACGCTTCAGGGCAGAGCTTGC
AATCGACACCATCGCTCAGTTAGAGAGCAGTATGCTGCTAGGCTTACAGCACTGGGGTGTATCTGCCGTGCTCTT
CTTGCCCTTGGCAAGGAATCATGCTGCGAGCCTCGAAAGCGCTCTTCGCTGGGTAAGGGTCGGAGCTCTGAACGG
CCACTGAAACAGTCTGTCTCGTGCGTCTCGGTTGAATCTTGCTGCGCAAGTAGTAAATCTTCAAGTCAATCGCCG
CTTCGAAGTACCGACCATGGCGGAAAGTACAAGCCTGCACGTGTAACTAAAACTCGTGCCAGCCAAGGTTGCTCC
ACCAACTCTTGCTGCAAACCCAAAATTACCACCTGCGGCAACAACTTCACCGACCCCTGTATCTCCGAATCAGAT
AAGTCAGAGATAAAGCCAGCGGATGGCTCTTGTGCTGATATTTGCTGTACCTCCGAAAAGCCATCCTTACCCAAC
GACGAGAAGGGTGGGGCTGTAAGAATTGCCCCTGATCTCGAGGGTCAGGCCATAGGCGTTGAGCATGTGGTCCTC
TCGATATCTGGTATGACTTGCACTGGCTGTGAGACGAAACTCAACAGAACCCTCGCGATAATGTCAGGGGTTGGG
AACTTGAGGACAAGTTTGGTTCTATCTCGAGCTGAATTCGACTTGGACCTCAGTATCTCTACTGTGGAGCTTGTT
ATAAAGCACTTGGAGCGGACCACAGAGTTCAAATGTGAGATAATCGCCAGTAATGGGTCAGCTATGGATATAATT
GTTTCTGGGGATCCAGGTTTGATCGTCAACCAGGCTTGGCCGCAAGGTGTGAGTGACATTTCGCTCGTCGGAAAT
TGCACTATTCGTGTATCTTTTGATCCAGAAGTGGTTGGAGCACGAGATCTCATTGAAAAGCACTGGGGTGATATA
GCAAGCCTTGCGCCCATCTCTGGTGATCCAACACTTGCAGCTGGTAGCAAGCATGTCCGCCATTCCGGGTTCATG
ACTCTCTTATCTGCAGTTCTTACCATCCCAGTCTTAATCATGGCATGGGCCCCCATCTCCGAGAGAAAAATCGCC
TATAGCTCCGCCTCGCTGGCTTTGGCTACTATCATTCAGGTTGTCATAGCAGGACCTTTTTATCCCAAAGCCTTG
AAGGCTCTTGTCTTTTCGCGAGTCATCGAGATGGACCTTCTTATTGTGTTAAGCACCAGCGTGGCATATATCTTC
TCTGTGGTTTCTTTCGGCTTTCTCGTTGCTAGTAGACCTCTTTCCACTGGCCAATTCTTTGAAACAAGCACACTT
CTAGTTACATTGATCATGTTCGGACGATATGTCGCTACACTTGCCCGACAAAAAGCGGTCGAGTCAATATCTATT
CGATCGCTTCAGGCCCAAACTGCCCTTCTTGTGGACGAATCACCTTCAATAGATGCTCGTGAAATCGACGTCAGG
CTACTGCAATACGGAGACAGGTTCAAGGTCCTTCCCGATATGAGAATCCCGACCGACGGGACTGTTGTATCTGGG
TCATCTGAAGTGAACGAGTCAATGCTCACCGGAGAGTCGCGGCATGTCGAAAAGAAACCCAAGTCGCGTGTCATT
GCAGGGACAATCAACGGATCGGCAAGTCTAATTGTCAGGCTAACTCGCCTCCCAGGCGACAACGCTATTAACACT
ATCGCCGCCATGGTCGATGAAGCCAAGCTTTCCAAACCAAAGATTCAAGAACTTGCCGACAAGGTGGCTTCATAT
TTTGTTCCAGTTATTGTAGGCTTGACTATTGCCACATTTGTTATTTGGGTGGCTCTTGGCATATCAATACAAGCT
AAGACTAGATCCGAAGCAACCGTGCAGGCTGTCACCTACGCCATCACGGTGCTTATAGTTTCATGTCCTTGTGCC
ATTGGTCTTGCCGTACCGATGGTGGTTGTCATCTGCAGCGGTATCGCAGCAGAGCGAGGGGTTATATTCAAGTCG
GCGCATTCTATCGAAGTCGCCTATAGAGCCTCTCATGTGGTCCTTGACAAGACAGGAACGCTGACTCAGGGAAAG
CTCAGCGTAGTCGTTGAGAGTTATCTCGGAGACGAGGAATCATGCCTGTCACTTCTTTTGGGCCTCATCGGTGAC
AGCAAGCACCCGGTATCGGTTGCTGTTGGTAATCATATTAGGCACAAGGGGATTGTTGCAACAGCTGTCCCTGAC
GTCAAAAGCTTGACAGGCCGAGGTGTGGAAGCTAAACTTGGTAGTCAAACGCTACAAGCTGGGAATTCTCGCTGG
CTGAAGACTTCCACGCACCCCCTGGTGCAACCGGTGCTTACAAAAGGCTATACTGTGTTCTGCTTCACCATCAAT
GGTGTGCTACTCGCTGTATTTGGTCTTGAGGACTCTCTCCGAGCTGATGCACCCCATGTGGTCAATACCCTACAG
AGACGCGGCGTGACGGTTCATGTGGTATCGGGCGACGACGAAGGCGCCGTGCAAAACGTGGCGACAAATTTAGCT
ATCCCCGAGAGCAACATTCGTGCTCGTAGCTCTCCAGCGGACAAGCAGGTCTACATCAAAGATCTCCTAGGCAGT
CTTTCAGGTGGTAAGGAGCCGATTGTCATCTTTTGCGGGGATGGCACCAATGACGCCGTGGCGCTCGCGCAAGCA
ACAGTCGGCGTTCACATAAACGAAGGCAGTGATGTTGCCCAGTCTGCAGCCGATGTCGTGCTTATGCGTCCATAT
CTGTCTGGCCTTCTCACCATGATGGATGCCAGCAAGGTCTCTATGAGACGTATCAAGTTCAATTTCGTTTGGAGT
TTTGTCTACAACACATTTGCCGTGCTACTTGCGGCTGGGGCTTTTGTGAATGTCAGAATTCCGCCCGAGTTTGCA
GGTCTGGGGGAGCTAATTAGCGTATTGCCCGTCATAATCGCTGCTGTGCTCTTACGATGGTCTATCTAG
Transcript >Pro_DTO377G3_2|g3297.t1
ATGGGACGCTCTTGCTGTGAAAGGACGCCCTCTCAAGCGGATGCGATTGATAAAGCTGAGTTGAAGAAATCGAAT
AGTTCATCGAATTGTTGTGGCAGTTCATCGGAGACTTCAAGTCAAGAGAAGTCTTATAGGAACGGCGCTATCCGA
AAGAACGACAAAACAGATGATAATAATGCCAATGCAACTTCCGCTGCCCAGCGTGATGACCCCGTATACAAGGAC
CCTATTGATCCTTGTAAGGGTGCAGCTCTGCCTGGGGCTTGCGAGGAAGGCTGCTGCGACCAGTCTGCCTCGGCT
GCTGGAAATTTTACCGCCAAATCTAAAATTTTAAGCTCTAGTGTTTCTTCGGGCCACCCTCACACACACACCGGC
TCCGGTACCCCATGGTCGAGTGAACATGCTACTTCCGTTGAACCTATTGTGGCAGAGTGCTGCCAAGACAAGCCT
TCGCCATGCTGTGATGAAGCCTGCCTTGATCGTCTGGCTTTACGTGAGTGTCATACGGGGTCAGATATACCATGC
ATGGAAGCAGCTGGTTACTCTCTTTCCTCGACATCCACACCGACAGAAGGTGCAACGCTTCAGGGCAGAGCTTGC
AATCGACACCATCGCTCAGTTAGAGAGCAGTATGCTGCTAGGCTTACAGCACTGGGGTGTATCTGCCGTGCTCTT
CTTGCCCTTGGCAAGGAATCATGCTGCGAGCCTCGAAAGCGCTCTTCGCTGGGTAAGGGTCGGAGCTCTGAACGG
CCACTGAAACAGTCTGTCTCGTGCGTCTCGGTTGAATCTTGCTGCGCAAGTAGTAAATCTTCAAGTCAATCGCCG
CTTCGAAGTACCGACCATGGCGGAAAGTACAAGCCTGCACGTGTAACTAAAACTCGTGCCAGCCAAGGTTGCTCC
ACCAACTCTTGCTGCAAACCCAAAATTACCACCTGCGGCAACAACTTCACCGACCCCTGTATCTCCGAATCAGAT
AAGTCAGAGATAAAGCCAGCGGATGGCTCTTGTGCTGATATTTGCTGTACCTCCGAAAAGCCATCCTTACCCAAC
GACGAGAAGGGTGGGGCTGTAAGAATTGCCCCTGATCTCGAGGGTCAGGCCATAGGCGTTGAGCATGTGGTCCTC
TCGATATCTGGTATGACTTGCACTGGCTGTGAGACGAAACTCAACAGAACCCTCGCGATAATGTCAGGGGTTGGG
AACTTGAGGACAAGTTTGGTTCTATCTCGAGCTGAATTCGACTTGGACCTCAGTATCTCTACTGTGGAGCTTGTT
ATAAAGCACTTGGAGCGGACCACAGAGTTCAAATGTGAGATAATCGCCAGTAATGGGTCAGCTATGGATATAATT
GTTTCTGGGGATCCAGGTTTGATCGTCAACCAGGCTTGGCCGCAAGGTGTGAGTGACATTTCGCTCGTCGGAAAT
TGCACTATTCGTGTATCTTTTGATCCAGAAGTGGTTGGAGCACGAGATCTCATTGAAAAGCACTGGGGTGATATA
GCAAGCCTTGCGCCCATCTCTGGTGATCCAACACTTGCAGCTGGTAGCAAGCATGTCCGCCATTCCGGGTTCATG
ACTCTCTTATCTGCAGTTCTTACCATCCCAGTCTTAATCATGGCATGGGCCCCCATCTCCGAGAGAAAAATCGCC
TATAGCTCCGCCTCGCTGGCTTTGGCTACTATCATTCAGGTTGTCATAGCAGGACCTTTTTATCCCAAAGCCTTG
AAGGCTCTTGTCTTTTCGCGAGTCATCGAGATGGACCTTCTTATTGTGTTAAGCACCAGCGTGGCATATATCTTC
TCTGTGGTTTCTTTCGGCTTTCTCGTTGCTAGTAGACCTCTTTCCACTGGCCAATTCTTTGAAACAAGCACACTT
CTAGTTACATTGATCATGTTCGGACGATATGTCGCTACACTTGCCCGACAAAAAGCGGTCGAGTCAATATCTATT
CGATCGCTTCAGGCCCAAACTGCCCTTCTTGTGGACGAATCACCTTCAATAGATGCTCGTGAAATCGACGTCAGG
CTACTGCAATACGGAGACAGGTTCAAGGTCCTTCCCGATATGAGAATCCCGACCGACGGGACTGTTGTATCTGGG
TCATCTGAAGTGAACGAGTCAATGCTCACCGGAGAGTCGCGGCATGTCGAAAAGAAACCCAAGTCGCGTGTCATT
GCAGGGACAATCAACGGATCGGCAAGTCTAATTGTCAGGCTAACTCGCCTCCCAGGCGACAACGCTATTAACACT
ATCGCCGCCATGGTCGATGAAGCCAAGCTTTCCAAACCAAAGATTCAAGAACTTGCCGACAAGGTGGCTTCATAT
TTTGTTCCAGTTATTGTAGGCTTGACTATTGCCACATTTGTTATTTGGGTGGCTCTTGGCATATCAATACAAGCT
AAGACTAGATCCGAAGCAACCGTGCAGGCTGTCACCTACGCCATCACGGTGCTTATAGTTTCATGTCCTTGTGCC
ATTGGTCTTGCCGTACCGATGGTGGTTGTCATCTGCAGCGGTATCGCAGCAGAGCGAGGGGTTATATTCAAGTCG
GCGCATTCTATCGAAGTCGCCTATAGAGCCTCTCATGTGGTCCTTGACAAGACAGGAACGCTGACTCAGGGAAAG
CTCAGCGTAGTCGTTGAGAGTTATCTCGGAGACGAGGAATCATGCCTGTCACTTCTTTTGGGCCTCATCGGTGAC
AGCAAGCACCCGGTATCGGTTGCTGTTGGTAATCATATTAGGCACAAGGGGATTGTTGCAACAGCTGTCCCTGAC
GTCAAAAGCTTGACAGGCCGAGGTGTGGAAGCTAAACTTGGTAGTCAAACGCTACAAGCTGGGAATTCTCGCTGG
CTGAAGACTTCCACGCACCCCCTGGTGCAACCGGTGCTTACAAAAGGCTATACTGTGTTCTGCTTCACCATCAAT
GGTGTGCTACTCGCTGTATTTGGTCTTGAGGACTCTCTCCGAGCTGATGCACCCCATGTGGTCAATACCCTACAG
AGACGCGGCGTGACGGTTCATGTGGTATCGGGCGACGACGAAGGCGCCGTGCAAAACGTGGCGACAAATTTAGCT
ATCCCCGAGAGCAACATTCGTGCTCGTAGCTCTCCAGCGGACAAGCAGGTCTACATCAAAGATCTCCTAGGCAGT
CTTTCAGGTGGTAAGGAGCCGATTGTCATCTTTTGCGGGGATGGCACCAATGACGCCGTGGCGCTCGCGCAAGCA
ACAGTCGGCGTTCACATAAACGAAGGCAGTGATGTTGCCCAGTCTGCAGCCGATGTCGTGCTTATGCGTCCATAT
CTGTCTGGCCTTCTCACCATGATGGATGCCAGCAAGGTCTCTATGAGACGTATCAAGTTCAATTTCGTTTGGAGT
TTTGTCTACAACACATTTGCCGTGCTACTTGCGGCTGGGGCTTTTGTGAATGTCAGAATTCCGCCCGAGTTTGCA
GGTCTGGGGGAGCTAATTAGCGTATTGCCCGTCATAATCGCTGCTGTGCTCTTACGATGGTCTATCTAG
Gene >Pro_DTO377G3_2|g3297.t1
ATGGGACGCTCTTGCTGTGAAAGGACGCCCTCTCAAGCGGATGCGATTGATAAAGCTGAGTTGAAGAAATCGAAT
AGTTCATCGAATTGTTGTGGCAGTTCATCGGAGACTTCAAGTCAAGAGAAGTCTTATAGGAACGGCGCTATCCGA
AAGAACGACAAAACAGATGATAATAATGCCAATGCAACTTCCGCTGCCCAGCGTGATGACCCCGTATACAAGGAC
CCTATTGATCCTTGTAAGGGTGCAGCTCTGCCTGGGGCTTGCGAGGAAGGCTGCTGCGACCAGTCTGCCTCGGCT
GCTGGTAAGAATATCCGTCGTCTTGATGCTTTTTCCGCTAACGTAGCTTGTTGCGCAGGAAATTTTACCGCCAAA
TCTAAAATTTTAAGCTCTAGTGTTTCTTCGGGCCACCCTCACACACACACCGGCTCCGGTACCCCATGGTCGAGT
GAACATGCTACTTCCGTTGAACCTATTGTGGCAGAGTGCTGCCAAGACAAGCCTTCGCCATGCTGTGATGAAGCC
TGCCTTGATCGTCTGGCTTTACGTGAGTGTCATACGGGGTCAGATATACCATGCATGGAAGCAGCTGGTTACTGT
ATGTTGAATATAAATGGCTTATGTCATAGTACTCTACTAATTTTGGGTCTAATGCAGCTCTTTCCTCGACATCCA
CACCGACAGAAGGTGCAACGCTTCAGGGCAGAGCTTGCAATCGACACCATCGCTCAGTTAGAGAGCAGTATGCTG
CTAGGCTTACAGCACTGGGGTGTATCTGCCGTGCTCTTCTTGCCCTTGGCAAGGAATCATGCTGCGAGCCTCGAA
AGCGCTCTTCGCTGGGTAAGGGTCGGAGCTCTGAACGGCCACTGAAACAGTCTGTCTCGTGCGTCTCGGTTGAAT
CTTGCTGCGCAAGTAGTAAATCTTCAAGTCAATCGCCGCTTCGAAGTACCGACCATGGCGGAAAGTACAAGCCTG
CACGTGTAACTAAAACTCGTGCCAGCCAAGGTTGCTCCACCAACTCTTGCTGCAAACCCAAAATTACCACCTGCG
GCAACAACTTCACCGACCCCTGTATCTCCGAATCAGATAAGTCAGAGATAAAGCCAGCGGATGGCTCTTGTGCTG
ATATTTGCTGTACCTCCGAAAAGCCATCCTTACCCAACGACGAGAAGGGTGGGGCTGTAAGAATTGCCCCTGATC
TCGAGGGTCAGGCCATAGGCGTTGAGCATGTGGTCCTCTCGATATCTGGTATGACTTGCACTGGCTGTGAGACGA
AACTCAACAGAACCCTCGCGATAATGTCAGGGGTTGGGAACTTGAGGACAAGTTTGGTTCTATCTCGAGCTGAAT
TCGACTTGGACCTCAGTATCTCTACTGTGGAGCTTGTTATAAAGCACTTGGAGCGGACCACAGAGTTCAAATGTG
AGATAATCGCCAGTAATGGGTCAGCTATGGATATAATTGTTTCTGGGGATCCAGGTTTGATCGTCAACCAGGCTT
GGCCGCAAGGTGTGAGTGACATTTCGCTCGTCGGAAATTGCACTATTCGTGTATCTTTTGATCCAGAAGTGGTTG
GAGCACGAGATCTCATTGAAAAGCACTGGGGTGATATAGCAAGCCTTGCGCCCATCTCTGGTGATCCAACACTTG
CAGCTGGTAGCAAGCATGTCCGCCATTCCGGGTTCATGACTCTCTTATCTGCAGTTCTTACCATCCCAGTCTTAA
TCATGGCATGGGCCCCCATCTCCGAGAGAAAAATCGCCTATAGCTCCGCCTCGCTGGCTTTGGCTACTATCATTC
AGGTTGTCATAGCAGGACCTTTTTATCCCAAAGCCTTGAAGGCTCTTGTCTTTTCGCGAGTCATCGAGATGGACC
TTCTTATTGTGTTAAGCACCAGCGTGGCATATATCTTCTCTGTGGTTTCTTTCGGCTTTCTCGTTGCTAGTAGAC
CTCTTTCCACTGGCCAATTCTTTGAAACAAGCACACTTCTAGTTACATTGATCATGTTCGGACGATATGTCGCTA
CACTTGCCCGACAAAAAGCGGTCGAGTCAATATCTATTCGATCGCTTCAGGCCCAAACTGCCCTTCTTGTGGACG
AATCACCTTCAATAGATGCTCGTGAAATCGACGTCAGGCTACTGCAATACGGAGACAGGTTCAAGGTCCTTCCCG
ATATGAGAATCCCGACCGACGGGACTGTTGTATCTGGGTCATCTGAAGTGAACGAGTCAATGCTCACCGGAGAGT
CGCGGCATGTCGAAAAGAAACCCAAGTCGCGTGTCATTGCAGGGACAATCAACGGATCGGCAAGTCTAATTGTCA
GGCTAACTCGCCTCCCAGGCGACAACGCTATTAACACTATCGCCGCCATGGTCGATGAAGCCAAGCTTTCCAAAC
CAAAGATTCAAGAACTTGCCGACAAGGTGGCTTCATATTTTGTTCCAGTTATTGTAGGCTTGACTATTGCCACAT
TTGTTATTTGGGTGGCTCTTGGCATATCAATACAAGCTAAGACTAGATCCGAAGCAACCGTGCAGGCTGTCACCT
ACGCCATCACGGTGCTTATAGTTTCATGTCCTTGTGCCATTGGTCTTGCCGTACCGATGGTGGTTGTCATCTGCA
GCGGTATCGCAGCAGAGCGAGGGGTTATATTCAAGTCGGCGCATTCTATCGAAGTCGCCTATAGAGCCTCTCATG
TGGTCCTTGACAAGACAGGAACGCTGACTCAGGGAAAGCTCAGCGTAGTCGTTGAGAGTTATCTCGGAGACGAGG
AATCATGCCTGTCACTTCTTTTGGGCCTCATCGGTGACAGCAAGCACCCGGTATCGGTTGCTGTTGGTAATCATA
TTAGGCACAAGGGGATTGTTGCAACAGCTGTCCCTGACGTCAAAAGCTTGACAGGCCGAGGTGTGGAAGCTAAAC
TTGGTAGTCAAACGCTACAAGCTGGGAATTCTCGCTGGCTGAAGACTTCCACGCACCCCCTGGTGCAACCGGTGC
TTACAAAAGGCTATACTGTGTTCTGCTTCACCATCAATGGTGTGCTACTCGCTGTATTTGGTCTTGAGGACTCTC
TCCGAGCTGATGCACCCCATGTGGTCAATACCCTACAGAGACGCGGCGTGACGGTTCATGTGGTATCGGGCGACG
ACGAAGGCGCCGTGCAAAACGTGGCGACAAATTTAGCTATCCCCGAGAGCAACATTCGTGCTCGTAGCTCTCCAG
CGGACAAGCAGGTCTACATCAAAGATCTCCTAGGCAGTCTTTCAGGTGGTAAGGAGCCGATTGTCATCTTTTGCG
GGGATGGCACCAATGACGCCGTGGCGCTCGCGCAAGCAACAGTCGGCGTTCACATAAACGAAGGCAGTGATGTTG
CCCAGTCTGCAGCCGATGTCGTGCTTATGCGTCCATATCTGTCTGGCCTTCTCACCATGATGGATGCCAGCAAGG
TCTCTATGAGACGTATCAAGTTCAATTTCGTTTGGAGTTTTGTCTACAACACATTTGCCGTGCTACTTGCGGCTG
GGGCTTTTGTGAATGTCAGAATTCCGCCCGAGTTTGCAGGTCTGGGGGAGCTAATTAGCGTATTGCCCGTCATAA
TCGCTGCTGTGCTCTTACGATGGTCTATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail