Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g329.t1
Gene name
Locationscaffold_01:836819..837380
Strand+
Gene length (bp)561
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02018 CBM_4_9 Carbohydrate binding domain 1.3E-12 7 124

GO

GO Term Description Terminal node
GO:0016798 hydrolase activity, acting on glycosyl bonds Yes
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g329.t1
MALSACNAVSNPSFETGILAPWHPSAVNVAQVSNGTIAYSGDYYLNLQTAVGNRGNTISQGLRHLKPHTEYKFSA
QAQVPSPSGSEYCSVYVYVGRNATVGSIASVQLFNFGEWTEVTGSYVPKRENEILSIGAACDSEDSSYTDNVLFD
DISFIPNDCAYGLA*
Coding >Pro_DTO377G3_2|g329.t1
ATGGCTCTCTCCGCATGTAATGCCGTGTCAAACCCTTCTTTTGAAACCGGCATCCTGGCTCCATGGCATCCATCG
GCCGTGAATGTGGCCCAAGTAAGCAATGGCACAATCGCATACAGTGGTGATTATTACCTTAACCTTCAAACCGCA
GTAGGAAACCGCGGCAACACCATCTCCCAGGGCTTAAGACACCTCAAGCCTCACACGGAATACAAATTCAGTGCT
CAGGCTCAGGTTCCATCGCCTTCCGGCTCAGAGTACTGCTCGGTCTATGTTTACGTTGGCCGCAATGCAACAGTC
GGTAGCATCGCCTCGGTACAGCTGTTCAATTTTGGGGAGTGGACGGAGGTCACAGGGAGCTATGTGCCAAAGAGG
GAGAATGAGATCTTGAGTATTGGCGCTGCTTGTGATTCGGAGGATTCTTCTTATACGGATAATGTTTTGTTTGAT
GACATTAGCTTCATTCCCAATGATTGTGCGTATGGTTTGGCTTAG
Transcript >Pro_DTO377G3_2|g329.t1
ATGGCTCTCTCCGCATGTAATGCCGTGTCAAACCCTTCTTTTGAAACCGGCATCCTGGCTCCATGGCATCCATCG
GCCGTGAATGTGGCCCAAGTAAGCAATGGCACAATCGCATACAGTGGTGATTATTACCTTAACCTTCAAACCGCA
GTAGGAAACCGCGGCAACACCATCTCCCAGGGCTTAAGACACCTCAAGCCTCACACGGAATACAAATTCAGTGCT
CAGGCTCAGGTTCCATCGCCTTCCGGCTCAGAGTACTGCTCGGTCTATGTTTACGTTGGCCGCAATGCAACAGTC
GGTAGCATCGCCTCGGTACAGCTGTTCAATTTTGGGGAGTGGACGGAGGTCACAGGGAGCTATGTGCCAAAGAGG
GAGAATGAGATCTTGAGTATTGGCGCTGCTTGTGATTCGGAGGATTCTTCTTATACGGATAATGTTTTGTTTGAT
GACATTAGCTTCATTCCCAATGATTGTGCGTATGGTTTGGCTTAG
Gene >Pro_DTO377G3_2|g329.t1
ATGGCTCTCTCCGCATGTAATGCCGTGTCAAACCCTTCTTTTGAAACCGGCATCCTGGCTCCATGGCATCCATCG
GCCGTGAATGTGGCCCAAGTAAGCAATGGCACAATCGCATACAGTGGTGATTATTACCTGTACGAATCTCCCTCC
CTGTCCAGCCAAACTACAATATCAGATACTAACGAAGTGATGTGTACCAGTAACCTTCAAACCGCAGTAGGAAAC
CGCGGCAACACCATCTCCCAGGGCTTAAGACACCTCAAGCCTCACACGGAATACAAATTCAGTGCTCAGGCTCAG
GTTCCATCGCCTTCCGGCTCAGAGTACTGCTCGGTCTATGTTTACGTTGGCCGCAATGCAACAGTCGGTAGCATC
GCCTCGGTACAGCTGTTCAATTTTGGGGAGTGGACGGAGGTCACAGGGAGCTATGTGCCAAAGAGGGAGAATGAG
ATCTTGAGTATTGGCGCTGCTTGTGATTCGGAGGATTCTTCTTATACGGATAATGTTTTGTTTGATGACATTAGC
TTCATTCCCAATGATTGTGCGTATGGTTTGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail