Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g324.t1
Gene name
Locationscaffold_01:822493..823490
Strand-
Gene length (bp)997
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 1.2E-26 164 268
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 1.4E-16 55 147

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.10 0.0 2.39
5d_25C Five days - 25 degrees Celsius 0.85 0.0 1.87
7d_25C Seven days - 25 degrees Celsius 1.60 0.0 3.22
10d_25C Ten days - 25 degrees Celsius 0.96 0.0 2.08
7d_15C Seven days - 15 degrees Celsius 0.22 0.0 0.64
7d_30C Seven days - 30 degrees Celsius 1.56 0.0 3.14

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.781870 no
3d_25C 7d_25C 0.602580 no
3d_25C 7d_15C 0.126215 no
3d_25C 7d_30C 0.640977 no
3d_25C 10d_25C 0.884308 no
5d_25C 7d_25C 0.374394 no
5d_25C 7d_15C 0.207981 no
5d_25C 7d_30C 0.402804 no
5d_25C 10d_25C 0.905648 no
7d_25C 7d_15C 0.083660 no
7d_25C 7d_30C 0.978287 no
7d_25C 10d_25C 0.475212 no
7d_15C 7d_30C 0.086230 no
7d_15C 10d_25C 0.169507 no
7d_30C 10d_25C 0.494862 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g324.t1
MFKTRFPQSITAKSASAATLLGIGAYCVQSRLISTANAESNEPPKVFSGFGFTTLRLQSTKDVNHNTKRLVFEFP
DQKATSGLALTSALLTISRPEGRWFPVLRPYTPISDLNQEGQIELMVKKYPNGKASSHIHSLSPGDTLTFATALK
GHAWTPNQSPQVYLIAGGAGITPIYQLAQGILNNPADKTKINLVFGVNTEQDLLLREELESFKTRFPGRFDYVYA
VSHPEGRSDGFRTGYITEGLLREVVKADGDAKVFVCGPPAMEDSLVGSRCQMGILARLGFAKGQIVRF*
Coding >Pro_DTO377G3_2|g324.t1
ATGTTCAAAACTCGTTTCCCCCAGTCCATAACAGCAAAATCAGCCTCGGCTGCCACTTTACTAGGCATCGGAGCT
TACTGTGTCCAATCGCGTCTTATATCAACTGCCAATGCAGAGTCAAATGAACCTCCCAAAGTCTTTTCAGGATTC
GGATTTACTACCTTACGCCTGCAAAGCACGAAAGATGTAAATCACAACACAAAACGGCTCGTCTTCGAGTTTCCA
GATCAGAAGGCCACAAGCGGATTGGCATTAACTTCGGCACTCCTCACCATATCCCGTCCCGAAGGACGCTGGTTC
CCCGTACTACGCCCATATACACCCATCAGCGATCTAAACCAAGAAGGCCAGATCGAGCTCATGGTCAAGAAATAC
CCAAACGGCAAAGCGAGCAGCCACATCCACTCCCTTTCACCAGGAGACACCCTCACATTCGCAACGGCACTCAAA
GGCCACGCCTGGACACCGAACCAATCCCCGCAGGTCTACCTCATAGCAGGCGGAGCAGGTATTACACCAATCTAC
CAGCTAGCGCAGGGTATTCTCAATAATCCAGCCGACAAAACTAAAATCAACCTTGTCTTTGGCGTCAATACCGAG
CAGGACCTGCTTCTGCGAGAAGAGCTGGAGAGCTTCAAGACGCGCTTCCCAGGTCGCTTTGACTATGTCTATGCA
GTCAGTCACCCGGAGGGACGGAGTGATGGGTTCAGGACGGGGTATATTACCGAGGGGCTGTTGCGGGAGGTTGTG
AAGGCCGATGGCGATGCGAAGGTCTTTGTTTGTGGGCCTCCTGCTATGGAGGATTCGTTGGTTGGATCGAGATGC
CAAATGGGTATTTTGGCTAGGCTTGGGTTTGCAAAGGGTCAGATTGTTAGGTTTTAG
Transcript >Pro_DTO377G3_2|g324.t1
ATGTTCAAAACTCGTTTCCCCCAGTCCATAACAGCAAAATCAGCCTCGGCTGCCACTTTACTAGGCATCGGAGCT
TACTGTGTCCAATCGCGTCTTATATCAACTGCCAATGCAGAGTCAAATGAACCTCCCAAAGTCTTTTCAGGATTC
GGATTTACTACCTTACGCCTGCAAAGCACGAAAGATGTAAATCACAACACAAAACGGCTCGTCTTCGAGTTTCCA
GATCAGAAGGCCACAAGCGGATTGGCATTAACTTCGGCACTCCTCACCATATCCCGTCCCGAAGGACGCTGGTTC
CCCGTACTACGCCCATATACACCCATCAGCGATCTAAACCAAGAAGGCCAGATCGAGCTCATGGTCAAGAAATAC
CCAAACGGCAAAGCGAGCAGCCACATCCACTCCCTTTCACCAGGAGACACCCTCACATTCGCAACGGCACTCAAA
GGCCACGCCTGGACACCGAACCAATCCCCGCAGGTCTACCTCATAGCAGGCGGAGCAGGTATTACACCAATCTAC
CAGCTAGCGCAGGGTATTCTCAATAATCCAGCCGACAAAACTAAAATCAACCTTGTCTTTGGCGTCAATACCGAG
CAGGACCTGCTTCTGCGAGAAGAGCTGGAGAGCTTCAAGACGCGCTTCCCAGGTCGCTTTGACTATGTCTATGCA
GTCAGTCACCCGGAGGGACGGAGTGATGGGTTCAGGACGGGGTATATTACCGAGGGGCTGTTGCGGGAGGTTGTG
AAGGCCGATGGCGATGCGAAGGTCTTTGTTTGTGGGCCTCCTGCTATGGAGGATTCGTTGGTTGGATCGAGATGC
CAAATGGGTATTTTGGCTAGGCTTGGGTTTGCAAAGGGTCAGATTGTTAGGTTTTAG
Gene >Pro_DTO377G3_2|g324.t1
ATGTTCAAAACTCGTTTCCCCCAGTCCATAACAGCAAAATCAGCCTCGGCTGCCACTTTACTAGGCATCGGAGCT
TACTGTGTCCAATCGCGTCTTATATCAACTGCCAATGCAGAGTCAAATGAACCTCCCAAAGTCTTTTCAGGATTC
GGATTTACTACCTTACGCCTGCAAAGCACGAAAGATGTAAATCACAACACAAAACGGCTCGTCTTCGAGTTTCCA
GATCAGAAGGCCACAAGCGGATTGGCATTAACTTGTATGGACCCGACTTACGATCAACGTTCTATAACAGCTTAT
ATACTAACATACTGCAGCGGCACTCCTCACCATATCCCGTCCCGAAGGACGCTGGTTCCCCGTACTACGCCCATA
TACACCCATCAGCGATCTAAGTACGAGTAATAAACCCAAGCCCGACATAACGATAGACTAACAAAAGAGAACAAT
AGACCAAGAAGGCCAGATCGAGCTCATGGTCAAGAAATACCCAAACGGCAAAGCGAGCAGCCACATCCACTCCCT
TTCACCAGGAGACACCCTCACATTCGCAACGGCACTCAAAGGCCACGCCTGGACACCGAACCAATCCCCGCAGGT
CTACCTCATAGCAGGCGGAGCAGGTATTACACCAATCTACCAGCTAGCGCAGGGTATTCTCAATAATCCAGCCGA
CAAAACTAAAATCAACCTTGTCTTTGGCGTCAATACCGAGCAGGACCTGCTTCTGCGAGAAGAGCTGGAGAGCTT
CAAGACGCGCTTCCCAGGTCGCTTTGACTATGTCTATGCAGTCAGTCACCCGGAGGGACGGAGTGATGGGTTCAG
GACGGGGTATATTACCGAGGGGCTGTTGCGGGAGGTTGTGAAGGCCGATGGCGATGCGAAGGTCTTTGTTTGTGG
GCCTCCTGCTATGGAGGATTCGTTGGTTGGATCGAGATGCCAAATGGGTATTTTGGCTAGGCTTGGGTTTGCAAA
GGGTCAGATTGTTAGGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail