Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3235.t1
Gene name
Locationscaffold_05:63108..65707
Strand-
Gene length (bp)2599
Transcript length (bp)2064
Coding sequence length (bp)2064
Protein length (aa) 688

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07731 Cu-oxidase_2 Multicopper oxidase 2.7E-36 527 644
PF07732 Cu-oxidase_3 Multicopper oxidase 3.2E-40 36 146
PF00394 Cu-oxidase Multicopper oxidase 3.9E-17 174 433

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0046914 transition metal ion binding No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3235.t1
MSVCRTSYAIWLALCYFVSHSNAILRTYNLTVHNDVKAPDGVSREVFLINGQLPGPLIEADEGDDLEIFVKNDLP
VDTSLHWHGILQRGSPDMDGVPGVTQYPIPPGGNFTYRFSIKDQYGFFWYHSHVRAYYNDGIRGPLLIRPSPQRL
RPFEKLAHSPHERDIILQTERDATSILLSDWTHELSDTIYARYFETGAFPNCVDSILANGFGRVECLPENMLQAG
PNMGYEDMNQRSSSMMAMSMAKRMDMDMDMSTDASATSSQMSTGTMAMDTTVDMTMSSTSMSAMPMSATMTMSDM
SPSMTSLSPRGCMPPMMFRQGYNVSSLPPETCTNTSSSLLTIPADHTSGWLALNLVNSGAVSKLHVSLDAHSMFV
YAADGLYVEIQEVKVLEIEIGQRYSVMIRLDQKPGNYYLRFASYPNGDMQQVLEGQAIVSYNMSMMSSRTPMNVT
VDPSTIWMLTNGSAKPDTSVLNPQLLSPFAPVNPPSAPADQTYTFTINQTDIVTWVVNDASYSEPKIPIIQGNVS
DGWQANTTIHVPSNSTIDIIMRIANDSMDTMSHPMHLHGHTFWVLGSGTGSFPYDSATDAPESLINLRNPPYRDT
TNLPPSGWAVIRYVTDNPGAWIFHCHIQWHMVSGMALVLVEGPDQFPALIGQSNNGTPPATSAAPMRRISSRQTA
LTAAAASLMMLG*
Coding >Pro_DTO377G3_2|g3235.t1
ATGTCCGTTTGCCGGACTTCGTACGCCATTTGGCTTGCACTTTGTTACTTTGTGTCTCATTCAAATGCTATTCTC
CGTACATACAACTTGACGGTGCATAATGACGTTAAAGCTCCGGATGGTGTCAGCCGCGAAGTCTTTCTGATCAAT
GGTCAGCTACCGGGGCCCCTAATCGAGGCAGACGAAGGCGACGATCTGGAAATCTTTGTCAAGAACGACCTCCCC
GTTGATACTTCTCTTCACTGGCACGGGATTTTGCAAAGGGGTAGTCCCGATATGGATGGAGTGCCTGGTGTCACG
CAGTATCCCATACCTCCTGGCGGTAACTTCACCTACAGATTCTCGATCAAAGATCAGTATGGCTTCTTCTGGTAT
CATTCCCACGTTAGAGCATACTACAATGACGGCATAAGAGGGCCACTCTTGATACGACCATCTCCCCAAAGACTG
CGGCCATTTGAAAAGCTTGCTCATAGCCCACACGAGCGTGATATCATTCTGCAGACGGAGAGGGACGCTACATCC
ATTCTTTTGAGTGACTGGACACATGAACTTTCGGACACCATTTACGCTCGATACTTTGAGACAGGCGCTTTTCCA
AATTGCGTCGACAGCATCCTTGCCAATGGATTCGGGAGGGTTGAGTGTTTACCGGAGAATATGCTCCAGGCAGGA
CCCAATATGGGATATGAAGATATGAACCAGCGTTCTTCATCAATGATGGCAATGTCAATGGCGAAACGAATGGAC
ATGGACATGGACATGAGCACGGACGCATCCGCCACATCTTCTCAGATGTCAACAGGTACGATGGCTATGGATACG
ACCGTGGATATGACTATGTCTAGCACTTCTATGTCCGCAATGCCGATGTCAGCTACAATGACGATGTCGGACATG
TCACCGTCCATGACTTCATTGAGTCCCCGTGGCTGTATGCCGCCAATGATGTTTAGGCAAGGCTACAATGTCAGT
TCACTCCCACCTGAGACCTGCACCAATACTTCGTCGTCCTTGCTCACCATCCCTGCGGATCACACGAGTGGTTGG
CTCGCGCTGAATCTGGTCAACTCCGGTGCAGTCAGCAAGTTACATGTCTCTCTGGATGCACACTCTATGTTTGTC
TATGCTGCCGACGGATTGTATGTGGAAATACAGGAGGTGAAGGTCCTGGAAATAGAGATCGGCCAACGGTACTCA
GTGATGATTCGACTTGATCAGAAACCGGGGAATTACTATCTCAGATTCGCATCATACCCCAATGGTGACATGCAA
CAAGTGCTTGAAGGGCAAGCTATTGTGTCCTATAACATGAGCATGATGAGCAGCAGAACCCCAATGAACGTCACG
GTCGATCCCTCAACCATTTGGATGTTGACCAACGGATCAGCCAAACCTGATACCAGCGTACTTAATCCTCAGTTG
CTTTCTCCCTTCGCGCCTGTCAACCCTCCCTCAGCACCAGCAGATCAGACATACACTTTCACAATTAATCAGACC
GACATTGTGACATGGGTAGTGAATGACGCCTCATACTCTGAGCCAAAAATACCAATCATCCAGGGCAACGTATCA
GACGGTTGGCAGGCGAATACAACCATCCATGTGCCGTCTAACTCAACGATTGATATTATTATGAGAATTGCAAAC
GATTCGATGGATACGATGAGCCATCCCATGCACCTACACGGCCACACTTTCTGGGTGCTTGGGTCCGGTACCGGC
TCTTTCCCGTATGATTCCGCGACGGACGCCCCAGAATCCCTAATAAATCTTCGAAATCCTCCTTATCGTGACACA
ACTAATCTTCCTCCGTCAGGATGGGCCGTGATCCGATATGTTACGGATAATCCCGGCGCGTGGATCTTTCACTGC
CATATCCAGTGGCACATGGTGAGCGGCATGGCACTTGTCCTTGTTGAAGGACCGGATCAATTTCCCGCCCTGATT
GGTCAGTCTAATAATGGTACCCCTCCTGCTACGTCAGCGGCGCCGATGCGTCGTATCAGCTCTCGTCAGACTGCT
TTGACTGCTGCTGCTGCCAGTCTCATGATGTTGGGATGA
Transcript >Pro_DTO377G3_2|g3235.t1
ATGTCCGTTTGCCGGACTTCGTACGCCATTTGGCTTGCACTTTGTTACTTTGTGTCTCATTCAAATGCTATTCTC
CGTACATACAACTTGACGGTGCATAATGACGTTAAAGCTCCGGATGGTGTCAGCCGCGAAGTCTTTCTGATCAAT
GGTCAGCTACCGGGGCCCCTAATCGAGGCAGACGAAGGCGACGATCTGGAAATCTTTGTCAAGAACGACCTCCCC
GTTGATACTTCTCTTCACTGGCACGGGATTTTGCAAAGGGGTAGTCCCGATATGGATGGAGTGCCTGGTGTCACG
CAGTATCCCATACCTCCTGGCGGTAACTTCACCTACAGATTCTCGATCAAAGATCAGTATGGCTTCTTCTGGTAT
CATTCCCACGTTAGAGCATACTACAATGACGGCATAAGAGGGCCACTCTTGATACGACCATCTCCCCAAAGACTG
CGGCCATTTGAAAAGCTTGCTCATAGCCCACACGAGCGTGATATCATTCTGCAGACGGAGAGGGACGCTACATCC
ATTCTTTTGAGTGACTGGACACATGAACTTTCGGACACCATTTACGCTCGATACTTTGAGACAGGCGCTTTTCCA
AATTGCGTCGACAGCATCCTTGCCAATGGATTCGGGAGGGTTGAGTGTTTACCGGAGAATATGCTCCAGGCAGGA
CCCAATATGGGATATGAAGATATGAACCAGCGTTCTTCATCAATGATGGCAATGTCAATGGCGAAACGAATGGAC
ATGGACATGGACATGAGCACGGACGCATCCGCCACATCTTCTCAGATGTCAACAGGTACGATGGCTATGGATACG
ACCGTGGATATGACTATGTCTAGCACTTCTATGTCCGCAATGCCGATGTCAGCTACAATGACGATGTCGGACATG
TCACCGTCCATGACTTCATTGAGTCCCCGTGGCTGTATGCCGCCAATGATGTTTAGGCAAGGCTACAATGTCAGT
TCACTCCCACCTGAGACCTGCACCAATACTTCGTCGTCCTTGCTCACCATCCCTGCGGATCACACGAGTGGTTGG
CTCGCGCTGAATCTGGTCAACTCCGGTGCAGTCAGCAAGTTACATGTCTCTCTGGATGCACACTCTATGTTTGTC
TATGCTGCCGACGGATTGTATGTGGAAATACAGGAGGTGAAGGTCCTGGAAATAGAGATCGGCCAACGGTACTCA
GTGATGATTCGACTTGATCAGAAACCGGGGAATTACTATCTCAGATTCGCATCATACCCCAATGGTGACATGCAA
CAAGTGCTTGAAGGGCAAGCTATTGTGTCCTATAACATGAGCATGATGAGCAGCAGAACCCCAATGAACGTCACG
GTCGATCCCTCAACCATTTGGATGTTGACCAACGGATCAGCCAAACCTGATACCAGCGTACTTAATCCTCAGTTG
CTTTCTCCCTTCGCGCCTGTCAACCCTCCCTCAGCACCAGCAGATCAGACATACACTTTCACAATTAATCAGACC
GACATTGTGACATGGGTAGTGAATGACGCCTCATACTCTGAGCCAAAAATACCAATCATCCAGGGCAACGTATCA
GACGGTTGGCAGGCGAATACAACCATCCATGTGCCGTCTAACTCAACGATTGATATTATTATGAGAATTGCAAAC
GATTCGATGGATACGATGAGCCATCCCATGCACCTACACGGCCACACTTTCTGGGTGCTTGGGTCCGGTACCGGC
TCTTTCCCGTATGATTCCGCGACGGACGCCCCAGAATCCCTAATAAATCTTCGAAATCCTCCTTATCGTGACACA
ACTAATCTTCCTCCGTCAGGATGGGCCGTGATCCGATATGTTACGGATAATCCCGGCGCGTGGATCTTTCACTGC
CATATCCAGTGGCACATGGTGAGCGGCATGGCACTTGTCCTTGTTGAAGGACCGGATCAATTTCCCGCCCTGATT
GGTCAGTCTAATAATGGTACCCCTCCTGCTACGTCAGCGGCGCCGATGCGTCGTATCAGCTCTCGTCAGACTGCT
TTGACTGCTGCTGCTGCCAGTCTCATGATGTTGGGATGA
Gene >Pro_DTO377G3_2|g3235.t1
ATGTCCGTTTGCCGGACTTCGTACGCCATTTGGCTTGCACTTTGTTACTTTGTGTCTCATTCAAATGCTATTCTC
CGTACATACAACTTGACGGTGCATAATGACGTTAAAGCTCCGGGTACGTGGACCATGAGCGCCAAACATGGGACT
TTCAGAGCTAATTCCTAAATAGATGGTGTCAGCCGCGAAGTCTTTCTGATCAATGGTCAGCTACCGGGGCCCCTA
ATCGAGGCAGACGAAGGCGACGATCTGGAAATCTTTGTCAAGAACGACCTCCCCGTTGATACTTCTCTTCACTGG
CACGGTAAGTCACTTCCATGAGGAAACATTTTTTTTATTAGAACCAGTGATCACTGATTGTGCCATAACAGGGAT
TTTGCAAAGGGGTAGTCCCGATATGGATGGAGTGCCTGGTGTCACGCAGGTCAGTCCTTAAATATTTGACGGTAA
TTTACATCCTTGTTGCTGATTCTAGACCATAGTATCCCATACCTCCTGGCGGTAACTTCACCTACAGATTCTCGA
TCAAAGATCAGTATGGCTTCTTCTGGTATCATTCCCACGTTAGAGCATACTACAATGACGGCATAAGAGGGCCAC
TCTTGATACGACCATCTCCCCAAAGACTGCGGCCATTTGAAAAGCTTGCTCATAGCCCACACGAGCGTGATATCA
TTCTGCAGACGGAGAGGGACGCTACATCCATTCTTTTGAGTGACTGGACACATGAACTTTCGGACACCATTTACG
CTCGATACTTTGAGACAGGCGCTTTTCCAAATTGCGTCGACAGCATCCTTGCCAATGGATTCGGGAGGGTTGAGT
GTTTACCGGAGAATATGCTCCAGGCAGGACCCAATATGGGATATGAAGATATGAACCAGCGTTCTTCATCAATGA
TGGCAATGTCAATGGCGAAACGAATGGACATGGACATGGACATGAGCACGGACGCATCCGCCACATCTTCTCAGA
TGTCAACAGGTACGATGGCTATGGATACGACCGTGGATATGACTATGTCTAGCACTTCTATGTCCGCAATGCCGA
TGTCAGCTACAATGACGATGTCGGACATGTCACCGTCCATGACTTCATTGAGTCCCCGTGGCTGTATGCCGCCAA
TGATGTTTAGGCAAGGCTACAATGTCAGTTCACTCCCACCTGAGACCTGCACCAATACTTCGTCGTCCTTGCTCA
CCATCCCTGCGGATCACACGAGTGGTTGGCTCGCGCTGAATCTGGTCAACTCCGGTGCAGTCAGCAAGTTACATG
TCTCTCTGGATGCACACTCTATGTTTGTCTATGCTGCCGACGGATTGTATGTGGAAATACAGGAGGTGAAGGTGA
GCATACCTTTGAAGAGTATCCGTTATATCCCCCAGCCTGGGCTCACCACATGTCATTTTAGGTCCTGGAAATAGA
GATCGGCCAACGGTACTCAGTGATGATTCGACTTGATCAGAAACCGGGGAATTACTATCTCAGATTCGCATCATA
CCCCAATGGTGACATGCAACAAGTGCTTGAAGGGCAAGCTATTGTGTCCTATAACGTAAGAAAATCGGCAAGCAA
GTCGCGACCATATCATGCCCGTGCTGACTTTTCGTTTTCATTTTGCAGATGAGCATGATGAGCAGCAGAACCCCA
ATGAACGTCACGGTCGATCCCTCAACCATTTGGATGTTGACCAACGGATCAGCCAAACCTGATACCAGCGTACTT
AATCCTCAGTTGCTTTCTCCCTTCGCGCCTGTCAACCCTCCCTCAGCACCAGCAGATCAGACATACACTTTCACA
ATTAATCAGACCGACATTGTGACATGGGTAGTGAATGACGCCTCATACTCTGAGCCAAAAATACCAATCATCCAG
GGCAACGTATCAGACGGTTGGCAGGCGAATACAACCATCCATGTGCCGTCTAACTCAACGATTGATATTATTATG
AGAATTGCAAACGATTCGATGGATACGGTAAGTCTGTTGGATTAGTGATTCCAACGACCTTTCTATGATGTGGAC
AGCTGGAACTAATGGGGGATAAACTCACCGCAGATGAGCCATCCCATGCACCTACACGGCCACACTTTCTGGGTG
CTTGGGTCCGGTACCGGCTCTTTCCCGTATGATTCCGCGACGGACGCCCCAGAATCCCTAATAAATCTTCGAAAT
CCTCCTTATCGTGACACAACTAATCTTCCTCCGTCAGGATGGGCCGTGATCCGGTAAATCACCTGAATATTCTAC
TGGCAAGACAATAGCTTACCTTTTCTTAAAAACAGATATGTTACGGATAATCCCGGCGCGTGGATCTTTCACTGC
CATATCCAGTGGCACATGGTGGTGAGTACAAATGGCTAGACGGTCGTATCCTAAATAATCGCAAAAATCTTGGTC
TTGCTAACATTACATTATTTTCCTTCACAAGAGCGGCATGGCACTTGTCCTTGTTGAAGGACCGGATCAATTTCC
CGCCCTGATTGGTCAGTCTAATAATGGTACCCCTCCTGCTACGTCAGCGGCGCCGATGCGTCGTATCAGCTCTCG
TCAGACTGCTTTGACTGCTGCTGCTGCCAGTCTCATGATGTTGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail