Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3228.t1
Gene name
Locationscaffold_05:42406..43201
Strand+
Gene length (bp)795
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 4.9E-10 4 227

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 21.98 9.20 34.76
5d_25C Five days - 25 degrees Celsius 19.06 7.44 30.68
7d_25C Seven days - 25 degrees Celsius 16.79 6.45 27.13
10d_25C Ten days - 25 degrees Celsius 12.63 4.36 20.89
7d_15C Seven days - 15 degrees Celsius 15.19 5.66 24.71
7d_30C Seven days - 30 degrees Celsius 13.29 4.67 21.91

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.753411 no
3d_25C 7d_25C 0.493625 no
3d_25C 7d_15C 0.301800 no
3d_25C 7d_30C 0.147471 no
3d_25C 10d_25C 0.101429 no
5d_25C 7d_25C 0.786957 no
5d_25C 7d_15C 0.580240 no
5d_25C 7d_30C 0.348766 no
5d_25C 10d_25C 0.272556 no
7d_25C 7d_15C 0.833430 no
7d_25C 7d_30C 0.584543 no
7d_25C 10d_25C 0.481554 no
7d_15C 7d_30C 0.776501 no
7d_15C 10d_25C 0.672332 no
7d_30C 10d_25C 0.922694 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3228.t1
MFQIISDLHLESPAAYDVFEVNPKAPYLALLGDIGYVKDEGLFHFLRRQLEVFRIVFLVMGNHEAYHSSWSETKS
AVNKFKTRIDDTRGSSETLGKLVILDQTRYDISPGITVLGCTLFSRVAQAQKESVNFGLNDFYYIDDWTIEAHQD
AHHADLVWLNQEIEHISRSEPDRKVVVFTHFCPSTHAMVVDPRHRNSKISSAFMTDLSSEPCWENGVVKLWAFGH
THFNCDFQDLKTGKTVTSNQRGYYFTQSEGFDCEKTVEI*
Coding >Pro_DTO377G3_2|g3228.t1
ATGTTCCAGATTATTTCTGACCTGCACCTGGAATCTCCTGCTGCATATGACGTCTTCGAAGTCAACCCCAAGGCA
CCATATTTAGCCCTACTCGGCGACATTGGCTATGTCAAAGACGAAGGCTTGTTCCACTTCCTGCGTAGGCAGCTG
GAAGTGTTCCGCATCGTTTTTTTGGTGATGGGTAATCACGAAGCGTATCACAGCAGCTGGTCTGAGACAAAATCC
GCCGTCAACAAGTTCAAAACGAGAATTGACGACACTCGAGGATCCAGCGAGACGCTCGGTAAACTTGTCATTCTC
GATCAAACGCGCTACGACATTTCACCTGGGATCACCGTCCTCGGATGTACTTTGTTCTCGCGGGTGGCCCAAGCA
CAAAAAGAAAGCGTTAATTTCGGTCTGAATGACTTCTATTACATTGATGATTGGACCATCGAAGCCCATCAAGAT
GCGCACCATGCCGATCTAGTGTGGCTGAACCAAGAAATTGAACATATTTCGCGCTCGGAGCCTGATCGTAAGGTT
GTCGTGTTTACTCATTTCTGCCCATCAACCCACGCTATGGTTGTCGATCCCAGACATAGGAACAGCAAAATCTCC
TCAGCTTTCATGACCGACCTATCAAGCGAGCCTTGTTGGGAAAATGGGGTTGTCAAACTTTGGGCTTTTGGCCAC
ACGCATTTCAATTGTGACTTCCAAGACTTGAAAACTGGGAAAACAGTGACCTCAAACCAAAGAGGTTATTACTTC
ACTCAGTCTGAAGGATTTGATTGTGAGAAGACGGTTGAAATCTAG
Transcript >Pro_DTO377G3_2|g3228.t1
ATGTTCCAGATTATTTCTGACCTGCACCTGGAATCTCCTGCTGCATATGACGTCTTCGAAGTCAACCCCAAGGCA
CCATATTTAGCCCTACTCGGCGACATTGGCTATGTCAAAGACGAAGGCTTGTTCCACTTCCTGCGTAGGCAGCTG
GAAGTGTTCCGCATCGTTTTTTTGGTGATGGGTAATCACGAAGCGTATCACAGCAGCTGGTCTGAGACAAAATCC
GCCGTCAACAAGTTCAAAACGAGAATTGACGACACTCGAGGATCCAGCGAGACGCTCGGTAAACTTGTCATTCTC
GATCAAACGCGCTACGACATTTCACCTGGGATCACCGTCCTCGGATGTACTTTGTTCTCGCGGGTGGCCCAAGCA
CAAAAAGAAAGCGTTAATTTCGGTCTGAATGACTTCTATTACATTGATGATTGGACCATCGAAGCCCATCAAGAT
GCGCACCATGCCGATCTAGTGTGGCTGAACCAAGAAATTGAACATATTTCGCGCTCGGAGCCTGATCGTAAGGTT
GTCGTGTTTACTCATTTCTGCCCATCAACCCACGCTATGGTTGTCGATCCCAGACATAGGAACAGCAAAATCTCC
TCAGCTTTCATGACCGACCTATCAAGCGAGCCTTGTTGGGAAAATGGGGTTGTCAAACTTTGGGCTTTTGGCCAC
ACGCATTTCAATTGTGACTTCCAAGACTTGAAAACTGGGAAAACAGTGACCTCAAACCAAAGAGGTTATTACTTC
ACTCAGTCTGAAGGATTTGATTGTGAGAAGACGGTTGAAATCTAG
Gene >Pro_DTO377G3_2|g3228.t1
ATGTTCCAGATTATTTCTGACCTGCACCTGGAATCTCCTGCTGCATATGACGTCTTCGAAGTCAACCCCAAGGCA
CCATATTTAGCCCTACTCGGCGACATTGGCTATGTCAAAGACGAAGGCTTGTTCCACTTCCTGCGTAGGCAGCTG
GAAGTGTTCCGCATCGTTTTTTTGGTGATGGGTAATCACGAAGCGTATCACAGCAGCTGGTCTGAGACAAAATCC
GCCGTCAACAAGTTCAAAACGAGAATTGACGACACTCGAGGATCCAGCGAGACGCTCGGTAAACTTGTCATTCTC
GATCAAACGCGCTACGACATTTCACCTGGGATCACCGTCCTCGGATGTACTTTGTTCTCGCGGGTGGCCCAAGCA
CAAAAAGAAAGCGTTAATTTCGGTCTGAATGACTTCTATTACATTGATGATTGGACCATCGAAGCCCATCAAGAT
GCGCACCATGCCGATCTAGTGTGGCTGAACCAAGAAATTGAACATATTTCGCGCTCGGAGCCTGATCGTAAGGTT
GTCGTGTTTACTCATTTCTGCCCATCAACCCACGCTATGGTTGTCGATCCCAGACATAGGAACAGCAAAATCTCC
TCAGCTTTCATGACCGACCTATCAAGCGAGCCTTGTTGGGAAAATGGGGTTGTCAAACTTTGGGCTTTTGGCCAC
ACGCATTTCAATTGTGACTTCCAAGACTTGAAAACTGGGAAAACAGTGACCTCAAACCAAAGAGGTTATTACTTC
ACTCAGTCTGAAGGATTTGATTGTGAGAAGACGGTTGAAATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail