Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3215.t1
Gene name
Locationscaffold_04:990189..991745
Strand-
Gene length (bp)1556
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03849 Tfb2 Transcription factor Tfb2 3.6E-133 10 383
PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain 1.5E-23 409 474

GO

GO Term Description Terminal node
GO:0001671 ATPase activator activity Yes
GO:0006289 nucleotide-excision repair Yes
GO:0000439 transcription factor TFIIH core complex Yes
GO:0090575 RNA polymerase II transcription regulator complex No
GO:0032991 protein-containing complex No
GO:0044260 cellular macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0006281 DNA repair No
GO:0006259 DNA metabolic process No
GO:0033554 cellular response to stress No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0098772 molecular function regulator activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005667 transcription regulator complex No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0006950 response to stress No
GO:0006974 cellular response to DNA damage stimulus No
GO:0140677 molecular function activator activity No
GO:0050896 response to stimulus No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0051716 cellular response to stimulus No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 49.79 29.61 69.97
5d_25C Five days - 25 degrees Celsius 55.85 33.53 78.17
7d_25C Seven days - 25 degrees Celsius 56.27 33.78 78.77
10d_25C Ten days - 25 degrees Celsius 69.10 41.88 96.33
7d_15C Seven days - 15 degrees Celsius 51.98 30.95 73.02
7d_30C Seven days - 30 degrees Celsius 57.29 34.30 80.27

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.693306 no
3d_25C 7d_25C 0.665767 no
3d_25C 7d_15C 0.898567 no
3d_25C 7d_30C 0.616820 no
3d_25C 10d_25C 0.145122 no
5d_25C 7d_25C 0.983564 no
5d_25C 7d_15C 0.820431 no
5d_25C 7d_30C 0.945091 no
5d_25C 10d_25C 0.394981 no
7d_25C 7d_15C 0.799123 no
7d_25C 7d_30C 0.961232 no
7d_25C 10d_25C 0.409984 no
7d_15C 7d_30C 0.748565 no
7d_15C 10d_25C 0.218621 no
7d_30C 10d_25C 0.470774 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3215.t1
MASATSRPLEYLEGLPGTTFYKLYQQPSTALAIFRRMLPDLAKCFVMALLYLKDPLPTADLEVWVNAESKKERDN
ALSILGRLHILSTTLTGENVRAYMVTNPFAASLRQALMGAEDSHSFGVFSQAPEQTPTSIADLDEYARRQWEGVM
GYMVGTSALMSGQRDTVNLSKGVKQLLQAGHLVEIRGNRVDITKDGFGFVLQDVNTQVWHILILYVESAEAIGMD
SVEVLSFLFLLSSLELGSSYDKSHMTPNQLRTLADLADFGIVYQEDADATRFYPTRLATTLTSDSSALSNPVTGS
LTGPVGPSGGSSSGFIIIETNYRLYAYTSSPLQISLISLFTNLKYRFPNLVTGKITRQSVRRAIEMGITADQIIS
YLLSHAHPQLRKHSAAQSNGKGVPASVLPPTVTDQIRLWQLERDRLRATAGFLFKDFTSLTEYQAPCQYAAEIGV
LVWKSDRKRMFFVTRHEQVAAFLRSQKVGGK*
Coding >Pro_DTO377G3_2|g3215.t1
ATGGCGAGTGCAACATCCCGTCCTCTGGAGTACCTGGAGGGACTCCCCGGGACGACTTTCTATAAGCTATACCAA
CAACCATCCACAGCCCTTGCGATCTTCCGGCGCATGCTGCCCGATCTGGCAAAATGCTTTGTGATGGCTCTACTC
TATCTGAAAGACCCTCTCCCAACTGCTGATCTGGAAGTTTGGGTCAACGCAGAGAGCAAGAAGGAACGAGATAAT
GCGCTTTCAATATTGGGTCGACTTCACATTCTTTCTACGACCCTCACAGGTGAAAACGTCCGTGCGTACATGGTC
ACCAACCCGTTCGCTGCTTCGCTTCGACAAGCTCTGATGGGTGCCGAGGACTCTCATTCTTTCGGTGTATTCTCC
CAAGCTCCAGAACAAACCCCAACCTCGATTGCCGATTTGGATGAATATGCTAGACGACAGTGGGAAGGTGTTATG
GGATACATGGTTGGAACGAGTGCCTTGATGAGTGGACAGCGTGACACGGTCAATTTGAGCAAGGGTGTCAAACAG
CTTCTCCAAGCGGGACACTTGGTTGAGATCCGAGGTAACCGTGTCGATATCACCAAAGACGGGTTCGGATTTGTG
CTTCAGGATGTGAATACCCAGGTCTGGCATATCTTGATTCTGTATGTCGAGAGCGCCGAGGCCATCGGCATGGAT
AGCGTCGAGGTTCTCTCGTTCCTATTCCTCCTGAGCAGTCTAGAACTCGGATCTTCTTACGACAAGAGCCACATG
ACACCCAACCAACTTCGCACTCTCGCGGACCTGGCTGATTTTGGTATTGTCTACCAGGAAGATGCCGACGCAACA
CGCTTTTATCCCACCCGTCTGGCAACTACACTTACATCCGACTCGAGCGCTCTGAGCAATCCTGTCACAGGATCC
CTCACTGGGCCAGTGGGGCCGTCTGGTGGTTCTAGCTCCGGTTTCATCATCATCGAAACTAACTATCGGCTCTAC
GCCTACACCTCATCACCCCTACAAATATCTCTCATCTCCCTTTTCACAAACCTCAAATACCGCTTCCCCAATCTG
GTCACTGGCAAAATCACCAGGCAGTCTGTCCGCCGAGCAATCGAGATGGGAATCACGGCCGATCAAATTATCTCT
TACCTATTATCGCACGCGCACCCACAGCTGCGGAAACACAGCGCTGCTCAATCCAACGGCAAGGGTGTCCCGGCA
TCTGTGCTCCCGCCTACTGTGACAGATCAGATCAGATTATGGCAGTTGGAGCGGGACCGTCTCCGGGCTACGGCG
GGCTTTTTGTTCAAGGATTTCACCAGCTTGACTGAATACCAGGCTCCCTGCCAGTATGCCGCGGAGATTGGCGTG
CTGGTTTGGAAGTCAGATCGGAAGCGCATGTTTTTTGTCACAAGACATGAGCAGGTGGCTGCATTTTTGCGGAGT
CAAAAGGTAGGCGGGAAGTAA
Transcript >Pro_DTO377G3_2|g3215.t1
ATGGCGAGTGCAACATCCCGTCCTCTGGAGTACCTGGAGGGACTCCCCGGGACGACTTTCTATAAGCTATACCAA
CAACCATCCACAGCCCTTGCGATCTTCCGGCGCATGCTGCCCGATCTGGCAAAATGCTTTGTGATGGCTCTACTC
TATCTGAAAGACCCTCTCCCAACTGCTGATCTGGAAGTTTGGGTCAACGCAGAGAGCAAGAAGGAACGAGATAAT
GCGCTTTCAATATTGGGTCGACTTCACATTCTTTCTACGACCCTCACAGGTGAAAACGTCCGTGCGTACATGGTC
ACCAACCCGTTCGCTGCTTCGCTTCGACAAGCTCTGATGGGTGCCGAGGACTCTCATTCTTTCGGTGTATTCTCC
CAAGCTCCAGAACAAACCCCAACCTCGATTGCCGATTTGGATGAATATGCTAGACGACAGTGGGAAGGTGTTATG
GGATACATGGTTGGAACGAGTGCCTTGATGAGTGGACAGCGTGACACGGTCAATTTGAGCAAGGGTGTCAAACAG
CTTCTCCAAGCGGGACACTTGGTTGAGATCCGAGGTAACCGTGTCGATATCACCAAAGACGGGTTCGGATTTGTG
CTTCAGGATGTGAATACCCAGGTCTGGCATATCTTGATTCTGTATGTCGAGAGCGCCGAGGCCATCGGCATGGAT
AGCGTCGAGGTTCTCTCGTTCCTATTCCTCCTGAGCAGTCTAGAACTCGGATCTTCTTACGACAAGAGCCACATG
ACACCCAACCAACTTCGCACTCTCGCGGACCTGGCTGATTTTGGTATTGTCTACCAGGAAGATGCCGACGCAACA
CGCTTTTATCCCACCCGTCTGGCAACTACACTTACATCCGACTCGAGCGCTCTGAGCAATCCTGTCACAGGATCC
CTCACTGGGCCAGTGGGGCCGTCTGGTGGTTCTAGCTCCGGTTTCATCATCATCGAAACTAACTATCGGCTCTAC
GCCTACACCTCATCACCCCTACAAATATCTCTCATCTCCCTTTTCACAAACCTCAAATACCGCTTCCCCAATCTG
GTCACTGGCAAAATCACCAGGCAGTCTGTCCGCCGAGCAATCGAGATGGGAATCACGGCCGATCAAATTATCTCT
TACCTATTATCGCACGCGCACCCACAGCTGCGGAAACACAGCGCTGCTCAATCCAACGGCAAGGGTGTCCCGGCA
TCTGTGCTCCCGCCTACTGTGACAGATCAGATCAGATTATGGCAGTTGGAGCGGGACCGTCTCCGGGCTACGGCG
GGCTTTTTGTTCAAGGATTTCACCAGCTTGACTGAATACCAGGCTCCCTGCCAGTATGCCGCGGAGATTGGCGTG
CTGGTTTGGAAGTCAGATCGGAAGCGCATGTTTTTTGTCACAAGACATGAGCAGGTGGCTGCATTTTTGCGGAGT
CAAAAGGTAGGCGGGAAGTAA
Gene >Pro_DTO377G3_2|g3215.t1
ATGGCGAGTGCAACATCCCGTCCTCTGGAGTACCTGGAGGGACTCCCCGGGACGACTTTCTATAAGCTATACCAA
CAACCATCCACAGCCCTTGCGATCTTCCGGCGCATGCTGCCCGATCTGGGTACATTAAGCTTACTCACACGGAAG
GGAACGTTGTGCTAACACTGAATATAGCAAAATGCTTTGTGATGGCTCTACTCTATCTGAAAGACCCTCTCCCAA
CTGCTGATCTGGAAGTTTGGGTCAACGCAGAGAGCAAGAAGTGAGTGGCTTATCTGACAGGTCTTGCTCTAGCCA
TTACTGACAGTGTTCACACAAGGGAACGAGATAATGCGCTTTCAATATTGGGTCGACTTCACATTCTTTCTACGA
CCCTCACAGGTGAAAACGTCCGTGCGTACATGGTCACCAACCCGTTCGCTGCTTCGCTTCGACAAGCTCTGATGG
GTGCCGAGGACTCTCATTCTTTCGGTGTATTCTCCCAAGCTCCAGAACAAACCCCAACCTCGATTGCCGATTTGG
ATGAATATGCTAGACGACAGTGGGAAGGTGTTATGGGATACATGGTTGGAACGAGTGCCTTGATGAGTGGACAGC
GTGACACGGTCAATTTGAGCAAGGGTGTCAAACAGCTTCTCCAAGCGGGACACTTGGTTGAGATCCGAGGTAACC
GTGTCGATATCACCAAAGACGGGTTCGGATTTGTGCTTCAGGATGTGAATACCCAGGTCTGGCATATCTTGATTC
TGTATGTCGAGAGCGCCGAGGCCATCGGCATGGATAGCGTCGAGGTTCTCTCGTTCCTATTCCTCCTGAGCAGTC
TAGAACTCGGATCTTCTTACGACAAGAGCCACATGACACCCAACCAACTTCGCACTCTCGCGGACCTGGCTGATT
TTGGTATTGTCTACCAGGAAGATGCCGACGCAACACGCTTTTATCCCACCCGTCTGGCAACTACACTTACATCCG
ACTCGAGCGCTCTGAGCAATCCTGTCACAGGATCCCTCACTGGGCCAGTGGGGCCGTCTGGTGGTTCTAGCTCCG
GTTTCATCATCATCGAAACTAACTATCGGCTCTACGCCTACACCTCATCACCCCTACAAATATCTCTCATCTCCC
TTTTCACAAACCTCAAATACCGCTTCCCCAATCTGGTCACTGGCAAAATCACCAGGCAGTCTGTCCGCCGAGCAA
TCGAGATGGGAATCACGGCCGATCAAATTATCTCTTACCTATTATCGCACGCGCACCCACAGCTGCGGAAACACA
GCGCTGCTCAATCCAACGGCAAGGGTGTCCCGGCATCTGTGCTCCCGCCTACTGTGACAGATCAGATCAGATTAT
GGCAGTTGGAGCGGGACCGTCTCCGGGCTACGGCGGGCTTTTTGTTCAAGGATTTCACCAGCTTGACTGAATACC
AGGCTCCCTGCCAGTATGCCGCGGAGATTGGCGTGCTGGTTTGGAAGTCAGATCGGAAGCGCATGTTTTTTGTCA
CAAGACATGAGCAGGTGGCTGCATTTTTGCGGAGTCAAAAGGTAGGCGGGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail