Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3203.t1
Gene name
Locationscaffold_04:961631..962849
Strand-
Gene length (bp)1218
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 1.3E-29 168 376
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 6.0E-08 196 374

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 302.96 181.60 424.32
5d_25C Five days - 25 degrees Celsius 272.51 163.53 381.49
7d_25C Seven days - 25 degrees Celsius 240.75 145.13 336.38
10d_25C Ten days - 25 degrees Celsius 211.48 128.96 294.00
7d_15C Seven days - 15 degrees Celsius 500.29 283.25 717.34
7d_30C Seven days - 30 degrees Celsius 217.28 132.18 302.37

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.715125 no
3d_25C 7d_25C 0.340172 no
3d_25C 7d_15C 0.018838 yes
3d_25C 7d_30C 0.128377 no
3d_25C 10d_25C 0.094810 no
5d_25C 7d_25C 0.657137 no
5d_25C 7d_15C 0.004840 yes
5d_25C 7d_30C 0.348389 no
5d_25C 10d_25C 0.278780 no
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.724067 no
7d_25C 10d_25C 0.638557 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.937815 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3203.t1
MKFLTLALSATASAMVIVNPEQQPLAPSIVQNPQSKSLIELAPYRTRWVTEEEKWSLKLDGVNFIDVTDEYQSGS
YGTLHTTRVVHYPGAMEHSHEILPLTETLDKSNMRSNLEHFTSFHTRYYKSQTGIESATWLFDQVTAAVHESGAS
DHGATVERFAHPWGQFSIIARIPGQTDNTVVLGSHQDSINLFLPSILAAPGADDDGSGTVTILEALRALLRSETI
THGKARNTIEFHWYSAEEGGLLGSQAVYANYKKNQRNVKAMLQQDMTGYVQGTLDAGEKESVGVIIDYVDQGLTA
FIKEVITTYCDVPYVETKCGYACSDHASASRYGYPSAFVIESQFENSDKRIHTTEDKIEYLSFDHMLQHAKMSLA
FAYELAFASF*
Coding >Pro_DTO377G3_2|g3203.t1
ATGAAGTTCCTCACTCTTGCGCTCAGCGCAACGGCATCTGCCATGGTCATAGTCAACCCGGAGCAACAACCTCTA
GCACCTTCAATTGTTCAAAACCCTCAGTCGAAGTCTCTGATTGAACTGGCCCCATACCGAACCCGATGGGTAACT
GAAGAAGAAAAATGGTCGCTCAAGCTGGACGGAGTGAACTTCATCGATGTCACCGATGAATACCAATCAGGCTCC
TACGGAACCCTCCACACCACGCGGGTCGTCCACTATCCAGGGGCTATGGAGCACTCACACGAAATTCTGCCTTTG
ACCGAAACTCTCGACAAGAGTAACATGAGAAGCAACCTGGAACACTTCACATCCTTCCACACGCGCTACTACAAG
TCGCAAACGGGAATCGAGTCAGCAACCTGGCTATTTGACCAAGTGACTGCTGCAGTGCACGAGTCTGGCGCCAGT
GACCACGGTGCAACCGTCGAGCGCTTCGCTCATCCCTGGGGTCAGTTCAGCATTATTGCGCGCATTCCCGGTCAG
ACGGATAACACCGTCGTCCTCGGTTCCCACCAGGATAGCATCAACTTGTTCCTGCCTTCGATCCTGGCTGCCCCG
GGCGCGGATGATGACGGAAGTGGAACAGTTACTATCCTCGAAGCTCTTCGCGCCCTGCTGCGGTCGGAGACTATA
ACCCACGGAAAAGCCCGTAACACTATCGAGTTCCACTGGTACTCTGCCGAGGAAGGTGGTTTACTCGGATCACAG
GCTGTATATGCTAATTACAAGAAGAACCAGCGGAACGTCAAGGCCATGCTCCAGCAAGACATGACTGGGTATGTT
CAGGGTACTCTTGATGCTGGCGAGAAGGAGTCTGTGGGTGTTATTATCGACTACGTCGACCAGGGCCTTACTGCG
TTCATTAAGGAGGTTATCACCACGTACTGCGATGTGCCCTATGTCGAGACAAAGTGTGGCTATGCATGCTCTGAT
CATGCTTCTGCTAGTCGGTACGGATACCCCTCGGCATTTGTGATCGAGTCTCAGTTCGAGAACTCCGATAAGAGG
ATCCACACTACCGAGGACAAGATCGAGTATTTGAGCTTCGATCATATGCTGCAGCATGCAAAGATGAGCTTGGCT
TTTGCTTACGAGCTGGCATTTGCTTCCTTCTGA
Transcript >Pro_DTO377G3_2|g3203.t1
ATGAAGTTCCTCACTCTTGCGCTCAGCGCAACGGCATCTGCCATGGTCATAGTCAACCCGGAGCAACAACCTCTA
GCACCTTCAATTGTTCAAAACCCTCAGTCGAAGTCTCTGATTGAACTGGCCCCATACCGAACCCGATGGGTAACT
GAAGAAGAAAAATGGTCGCTCAAGCTGGACGGAGTGAACTTCATCGATGTCACCGATGAATACCAATCAGGCTCC
TACGGAACCCTCCACACCACGCGGGTCGTCCACTATCCAGGGGCTATGGAGCACTCACACGAAATTCTGCCTTTG
ACCGAAACTCTCGACAAGAGTAACATGAGAAGCAACCTGGAACACTTCACATCCTTCCACACGCGCTACTACAAG
TCGCAAACGGGAATCGAGTCAGCAACCTGGCTATTTGACCAAGTGACTGCTGCAGTGCACGAGTCTGGCGCCAGT
GACCACGGTGCAACCGTCGAGCGCTTCGCTCATCCCTGGGGTCAGTTCAGCATTATTGCGCGCATTCCCGGTCAG
ACGGATAACACCGTCGTCCTCGGTTCCCACCAGGATAGCATCAACTTGTTCCTGCCTTCGATCCTGGCTGCCCCG
GGCGCGGATGATGACGGAAGTGGAACAGTTACTATCCTCGAAGCTCTTCGCGCCCTGCTGCGGTCGGAGACTATA
ACCCACGGAAAAGCCCGTAACACTATCGAGTTCCACTGGTACTCTGCCGAGGAAGGTGGTTTACTCGGATCACAG
GCTGTATATGCTAATTACAAGAAGAACCAGCGGAACGTCAAGGCCATGCTCCAGCAAGACATGACTGGGTATGTT
CAGGGTACTCTTGATGCTGGCGAGAAGGAGTCTGTGGGTGTTATTATCGACTACGTCGACCAGGGCCTTACTGCG
TTCATTAAGGAGGTTATCACCACGTACTGCGATGTGCCCTATGTCGAGACAAAGTGTGGCTATGCATGCTCTGAT
CATGCTTCTGCTAGTCGGTACGGATACCCCTCGGCATTTGTGATCGAGTCTCAGTTCGAGAACTCCGATAAGAGG
ATCCACACTACCGAGGACAAGATCGAGTATTTGAGCTTCGATCATATGCTGCAGCATGCAAAGATGAGCTTGGCT
TTTGCTTACGAGCTGGCATTTGCTTCCTTCTGA
Gene >Pro_DTO377G3_2|g3203.t1
ATGAAGTTCCTCACTCTTGCGCTCAGCGCAACGGCATCTGCCATGGTCATAGTCAACCCGGAGCAACAACCTCTA
GCACCTTCAATTGTTCAAAACCCTCAGTCGAAGTCTCTGATTGAACTGGCCCCATACCGAACCCGATGGGTAACT
GAAGAAGAAAAATGGTCGCTCAAGCTGGTAAGCCATTTTTTTTTTTTTGATTCGAAACTCAATGACATAGTACTA
ACCCCCGACTAGGACGGAGTGAACTTCATCGATGTCACCGATGAATACCAATCAGGCTCCTACGGAACCCTCCAC
ACCACGCGGGTCGTCCACTATCCAGGGGCTATGGAGCACTCACACGAAATTCTGCCTTTGACCGAAACTCTCGAC
AAGAGTAACATGAGAAGCAACCTGGAACACTTCACATCCTTCCACACGCGCTACTACAAGTCGCAAACGGGAATC
GAGTCAGCAACCTGGCTATTTGACCAAGTGACTGCTGCAGTGCACGAGTCTGGCGCCAGTGACCACGGTGCAACC
GTCGAGCGCTTCGCTCATCCCTGGGGTCAGTTCAGCATTATTGCGCGCATTCCCGGTCAGACGGATAACACCGTC
GTCCTCGGTTCCCACCAGGATAGCATCAACTTGTTCCTGCCTTCGATCCTGGCTGCCCCGGGCGCGGATGATGAC
GGAAGTGGAACAGTTACTATCCTCGAAGCTCTTCGCGCCCTGCTGCGGTCGGAGACTATAACCCACGGAAAAGCC
CGTAACACTATCGAGTTCCACTGGTACTCTGCCGAGGAAGGTGGTTTACTCGGATCACAGGCTGTATATGCTAAT
TACAAGAAGAACCAGCGGAACGTCAAGGCCATGCTCCAGCAAGACATGACTGGGTATGTTCAGGGTACTCTTGAT
GCTGGCGAGAAGGAGTCTGTGGGTGTTATTATCGACTACGTCGACCAGGGCCTTACTGCGTTCATTAAGGAGGTT
ATCACCACGTACTGCGATGTGCCCTATGTCGAGACAAAGTGTGGCTATGCATGCTCTGATCATGCTTCTGCTAGT
CGGTACGGATACCCCTCGGCATTTGTGATCGAGTCTCAGTTCGAGAACTCCGATAAGAGGATCCACACTACCGAG
GACAAGATCGAGTATTTGAGCTTCGATCATATGCTGCAGCATGCAAAGATGAGCTTGGCTTTTGCTTACGAGCTG
GCATTTGCTTCCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail