Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3198.t1
Gene name
Locationscaffold_04:950178..951617
Strand-
Gene length (bp)1439
Transcript length (bp)1329
Coding sequence length (bp)1329
Protein length (aa) 443

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-23 44 329

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 80 102 22
3 109 128 19
4 132 154 22
5 166 188 22
6 198 220 22
7 246 268 22
8 308 330 22
9 337 359 22
10 410 432 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.42 0.0 0.97
5d_25C Five days - 25 degrees Celsius 0.49 0.0 1.13
7d_25C Seven days - 25 degrees Celsius 0.44 0.0 0.99
10d_25C Ten days - 25 degrees Celsius 0.28 0.0 0.69
7d_15C Seven days - 15 degrees Celsius 0.35 0.0 0.80
7d_30C Seven days - 30 degrees Celsius 0.93 0.0 1.85

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 1.000000 no
3d_25C 7d_25C 1.000000 no
3d_25C 7d_15C 1.000000 no
3d_25C 7d_30C 0.275557 no
3d_25C 10d_25C 1.000000 no
5d_25C 7d_25C 1.000000 no
5d_25C 7d_15C 1.000000 no
5d_25C 7d_30C 0.396456 no
5d_25C 10d_25C 1.000000 no
7d_25C 7d_15C 1.000000 no
7d_25C 7d_30C 0.268759 no
7d_25C 10d_25C 1.000000 no
7d_15C 7d_30C 0.157617 no
7d_15C 10d_25C 1.000000 no
7d_30C 10d_25C 0.134928 no

Orthologs

Orthofinder run ID2
Orthogroup671
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g110.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g6037.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g4523.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g5075.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g7149.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g6488.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g7712.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g2793.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g7260.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g3754.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g3719.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g7021.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g4560.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g5011.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g4513.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g8051.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g4009.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g9601.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g4147.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g3634.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g2292.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g8527.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g5988.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g7608.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g7581.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g6828.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g5582.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g2385.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g8768.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g3595.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g5458.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g7844.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g8718.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g3198.t1 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3198.t1
MLSEKGKTQPEVTDLAHITEDEESSGIHSTFAVKSKVYSCLQVLGAFFIFFNVWGLNLAFGTFQSYYALTYIPSS
TSSDIAWIGTIQSWLLIVGGLLSGPLFDLGYNQSMILVGSTLGVVGIMMLSLAHDYYAIFLSQGVCMGLGFGLLY
VPAIALVSRSFTTRRAVALGISSSGAPVGGIIYTTMFNQLISKVGFAWTVRLVAFLMLALFIAAAIMLLWPERHA
VKVKNTQRRSLIDLRALKDLPFWSFAIGNFFLYLGYITPFYYIPTYAETKLGTSRSMASNILMISQASSVIGRVV
LTLFAHYYGSMIAWIICGILSGVLCICWISADSLARFVLFAAFYGGISGALIPLPPSVFTHVCPDPKSLGTWLGM
AQSLSSFASLVGPPIAGALASIGADGSADLNYLGIQLFSGIVMCFGAFQLIFLWYLLYKKRGKTGLF*
Coding >Pro_DTO377G3_2|g3198.t1
ATGTTATCGGAAAAAGGCAAGACGCAGCCCGAGGTCACAGATCTGGCACATATCACGGAAGATGAAGAGTCATCT
GGAATACACTCTACCTTTGCTGTAAAAAGTAAAGTGTATAGCTGTCTCCAAGTTCTCGGTGCTTTCTTTATATTC
TTCAATGTCTGGGGCCTCAACCTCGCATTTGGGACATTCCAAAGCTACTATGCACTCACCTATATCCCATCATCG
ACATCATCTGACATCGCCTGGATTGGAACGATTCAATCCTGGCTCCTAATCGTCGGCGGTCTACTATCCGGCCCA
CTTTTCGACCTTGGCTACAACCAGAGCATGATTCTCGTCGGCAGTACCCTAGGTGTAGTCGGCATAATGATGCTC
AGTCTTGCACATGACTACTACGCCATATTCCTAAGCCAGGGGGTCTGCATGGGCCTCGGATTCGGACTGCTTTAT
GTCCCTGCTATTGCATTGGTCAGCCGTTCTTTCACAACAAGAAGGGCTGTTGCGCTAGGTATTTCGAGTAGCGGT
GCGCCTGTCGGGGGTATTATCTATACAACGATGTTCAACCAGCTTATATCAAAGGTTGGGTTCGCCTGGACCGTC
CGCCTTGTGGCGTTCTTGATGCTGGCGCTGTTCATCGCGGCTGCTATTATGCTTTTGTGGCCGGAGAGACATGCA
GTGAAGGTTAAAAATACCCAGCGCAGGAGCTTGATTGATTTGCGCGCATTGAAGGATTTGCCTTTTTGGAGCTTT
GCTATCGGGAACTTTTTTCTTTACCTTGGTTATATCACGCCTTTCTATTACATTCCGACTTACGCGGAGACAAAA
CTAGGTACATCGCGCTCAATGGCCTCTAATATCTTGATGATTTCCCAGGCTTCTTCGGTTATTGGCCGTGTTGTC
TTGACTTTGTTCGCTCATTACTATGGGTCGATGATTGCTTGGATCATTTGCGGTATACTCTCAGGCGTTCTGTGT
ATTTGTTGGATCAGTGCAGACAGCCTTGCCCGGTTTGTTCTTTTTGCTGCCTTCTATGGTGGTATCTCCGGGGCT
TTGATTCCTCTGCCGCCGAGCGTTTTCACTCACGTCTGTCCCGATCCCAAGAGTCTTGGAACTTGGCTTGGAATG
GCGCAAAGCTTGAGTAGCTTTGCGAGTCTTGTGGGACCACCAATAGCAGGTGCGCTCGCTTCAATTGGCGCCGAT
GGTAGTGCGGATTTGAACTACTTGGGTATTCAATTGTTTAGTGGGATAGTCATGTGTTTTGGCGCATTCCAGCTG
ATCTTTTTATGGTATTTGCTGTACAAAAAGAGGGGCAAAACTGGTTTATTTTAA
Transcript >Pro_DTO377G3_2|g3198.t1
ATGTTATCGGAAAAAGGCAAGACGCAGCCCGAGGTCACAGATCTGGCACATATCACGGAAGATGAAGAGTCATCT
GGAATACACTCTACCTTTGCTGTAAAAAGTAAAGTGTATAGCTGTCTCCAAGTTCTCGGTGCTTTCTTTATATTC
TTCAATGTCTGGGGCCTCAACCTCGCATTTGGGACATTCCAAAGCTACTATGCACTCACCTATATCCCATCATCG
ACATCATCTGACATCGCCTGGATTGGAACGATTCAATCCTGGCTCCTAATCGTCGGCGGTCTACTATCCGGCCCA
CTTTTCGACCTTGGCTACAACCAGAGCATGATTCTCGTCGGCAGTACCCTAGGTGTAGTCGGCATAATGATGCTC
AGTCTTGCACATGACTACTACGCCATATTCCTAAGCCAGGGGGTCTGCATGGGCCTCGGATTCGGACTGCTTTAT
GTCCCTGCTATTGCATTGGTCAGCCGTTCTTTCACAACAAGAAGGGCTGTTGCGCTAGGTATTTCGAGTAGCGGT
GCGCCTGTCGGGGGTATTATCTATACAACGATGTTCAACCAGCTTATATCAAAGGTTGGGTTCGCCTGGACCGTC
CGCCTTGTGGCGTTCTTGATGCTGGCGCTGTTCATCGCGGCTGCTATTATGCTTTTGTGGCCGGAGAGACATGCA
GTGAAGGTTAAAAATACCCAGCGCAGGAGCTTGATTGATTTGCGCGCATTGAAGGATTTGCCTTTTTGGAGCTTT
GCTATCGGGAACTTTTTTCTTTACCTTGGTTATATCACGCCTTTCTATTACATTCCGACTTACGCGGAGACAAAA
CTAGGTACATCGCGCTCAATGGCCTCTAATATCTTGATGATTTCCCAGGCTTCTTCGGTTATTGGCCGTGTTGTC
TTGACTTTGTTCGCTCATTACTATGGGTCGATGATTGCTTGGATCATTTGCGGTATACTCTCAGGCGTTCTGTGT
ATTTGTTGGATCAGTGCAGACAGCCTTGCCCGGTTTGTTCTTTTTGCTGCCTTCTATGGTGGTATCTCCGGGGCT
TTGATTCCTCTGCCGCCGAGCGTTTTCACTCACGTCTGTCCCGATCCCAAGAGTCTTGGAACTTGGCTTGGAATG
GCGCAAAGCTTGAGTAGCTTTGCGAGTCTTGTGGGACCACCAATAGCAGGTGCGCTCGCTTCAATTGGCGCCGAT
GGTAGTGCGGATTTGAACTACTTGGGTATTCAATTGTTTAGTGGGATAGTCATGTGTTTTGGCGCATTCCAGCTG
ATCTTTTTATGGTATTTGCTGTACAAAAAGAGGGGCAAAACTGGTTTATTTTAA
Gene >Pro_DTO377G3_2|g3198.t1
ATGTTATCGGAAAAAGGCAAGACGCAGCCCGAGGTCACAGATCTGGCACATATCACGGAAGATGAAGAGTCATCT
GGAATACACTCTACCTTTGCTGTAAAAAGTAAAGTGTATAGCTGTCTCCAAGTTCTCGGTGCTTTCTTTATATTC
TTCAATGTCTGGTATGTGAAACATCTTTCGGCTTCCAATTGAATATCAAAACCAACTGATTTCCAGGGGCCTCAA
CCTCGCATTTGGGACATTCCAAAGCTACTATGCACTCACCTATATCCCATCATCGACATCATCTGACATCGCCTG
GATTGGAACGATTCAATCCTGGCTCCTAATCGTCGGCGGTCTACTATCCGGCCCACTTTTCGACCTTGGCTACAA
CCAGAGCATGATTCTCGTCGGCAGTACCCTAGGTGTAGTCGGCATAATGATGCTCAGTCTTGCACATGACTACTA
CGCCATATTCCTAAGCCAGGGGGTCTGCATGGGCCTCGGATTCGGACTGCTTTATGTCCCTGCTATTGCATTGGT
CAGCCGTTCTTTCACAACAAGAAGGGCTGTTGCGCTAGGTATTTCGAGTAGCGGTGCGCCTGTCGGGGGTATTAT
CTATACAACGATGTTCAACCAGCTTATATCAAAGGTTGGGTTCGCCTGGACCGTCCGCCTTGTGGCGTTCTTGAT
GCTGGCGCTGTTCATCGCGGCTGCTATTATGCTTTTGTGGCCGGAGAGACATGCAGTGAAGGTTAAAAATACCCA
GCGCAGGAGCTTGATTGATTTGCGCGCATTGAAGGATTTGCCTTTTTGGAGCTTTGCTATCGGGAACTTTTTTCT
TTACCTTGGTTATATCACGCCTTTCTATTACATTCCGACTTACGCGGAGACAAAACTAGGTACATCGCGCTCAAT
GGCCTCTAATATCTTGATGATTTCCCAGGCTTCTTCGGTTATTGGCCGTGTTGTCTTGACTTTGTTCGCTCATTA
CTATGGGTCGATGATTGCTTGGATCATTTGCGGTATACTCTCAGGCGTTCTGTGTATTTGTTGGATCAGTGCAGA
CAGCCTTGCCCGGTTTGTTCTTTTTGCTGCCTTCTATGGTAAGTGAAGTTCATTCTCCAAGTCATCGGTGCTCTA
TTTTGACCCAAATCACAGGTGGTATCTCCGGGGCTTTGATTCCTCTGCCGCCGAGCGTTTTCACTCACGTCTGTC
CCGATCCCAAGAGTCTTGGAACTTGGCTTGGAATGGCGCAAAGCTTGAGTAGCTTTGCGAGTCTTGTGGGACCAC
CAATAGCAGGTGCGCTCGCTTCAATTGGCGCCGATGGTAGTGCGGATTTGAACTACTTGGGTATTCAATTGTTTA
GTGGGATAGTCATGTGTTTTGGCGCATTCCAGCTGATCTTTTTATGGTATTTGCTGTACAAAAAGAGGGGCAAAA
CTGGTTTATTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail