Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g319.t1
Gene name
Locationscaffold_01:804957..811849
Strand+
Gene length (bp)6892
Transcript length (bp)6657
Coding sequence length (bp)6657
Protein length (aa) 2219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.7E-68 21 272
PF08659 KR KR domain 7.3E-64 1850 2028
PF00698 Acyl_transf_1 Acyl transferase domain 4.0E-50 552 868
PF14765 PS-DH Polyketide synthase dehydratase 4.9E-46 935 1251
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.7E-37 281 397
PF00106 adh_short short chain dehydrogenase 6.4E-16 1853 2011
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 4.5E-15 1692 1826
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 1.0E-14 401 489
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.3E-12 1651 1755
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.3E-11 1859 2011
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.7E-06 1534 1596
PF00550 PP-binding Phosphopantetheine attachment site 5.9E-06 2142 2206

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g319.t1
MTNMKGADSEGASYGDQGTLQPIAIIGYSCRLPGQVTSPSELWELCTRARSGWSPIPKDRFSVEAFHHPNSSKIG
SFNPKGGYFLDEDIAQFDAPFFNLTVQEATAMDPQQRLLLECAYEALESAGIPKENFARRNVSVFAGGNFADYEL
NNDRDTETIPMHQATGCAASLQSNRISYFFDLRGPSVTVDTACSSSLVALHYAVQSLRSGESKEALVAGCHLNIV
PDIWVSMSMSQLFNDEGKTFSFDERATSGFARGEGSGVVILKPLDAALRDKDPVRAVVVHSGVNQDGRTQGITLP
NGQAQEELIRQVYKEANINPDECGFVEMHGTGTKAGDPIEAAAVHAALGKNRTPRNPLYIGSVKSNIGHLEGASG
IIAIIKAAMMLDRELMLPNAEFKKANPNIPMSDWNMKVLTMTRPWPPRKKYLSVSNYGFGGTNAHAVLEKAPLSS
KAPDRAVEDVEVDPKRKLFLISANDKESLRTRIKDFGIYFEQHPEVFEKTLFGNFAYTLGNKMSQLSYRVGVSAT
SLDELGIRLAQLNINPSRVLGAPIISFVFTGQGAQWAQMGVPLMHEYPVYELAIKRADQCLRDLGAEFSLVEELE
KDATASDIDSPHLSQPACTALQIALVNLLESWGIRPGSVVGHSSGEISAAYAAGIYDLEGAMALAYWRGQMTSLL
KSSFPSLKGTMIAIGTSRETIQPILKNLSGYATVACVNSPTSVTVSGDISTISELEKVVDNKQLFNRKLKIDVAY
HSDHMKKVSKAYLAAIENIRHFSSAITPFFSSVFGRFAEPFELGPEYWIANLTSPVLFSDALGKIVADDETRPSL
LIEIGPHSTMKGPIMDTLKSLGPTVSKIAYTPTILRKVNAAESILDTAAAAYVRGATLNMTAVNFPKTGAANRWF
LSNLPRYPWQHGTRYWHVARIPQKHMVRDGARNDVLGVLANYSNDLEPTWRNIIRLDEVPYLRDHKMQGMVVYPL
AGYLVMAIEAARRRAKQADIQISQFELREVIVGSAFVLSDETDAETTITLRPYAEGTRGSSDLWDEFRVCSWTSK
RGWTEHCTGQVRVRSDPKQQAVVISSPFETQATYMKAQISRIQKPATNYLDMSHMYQVLGDLGAGYGPIFQNIDN
CYSSPHHSFGDLYVRNTRSVMPKGFETPLTVHPSFLDGLLHFAWPLLGQGLGRMDLDTLYMPTVIKRMTVGLNVP
TTAGEYLKGYCSGSPSLPSPEPTKFDLFATQEGSTEPIITIDGLVMTPLRDSDTNREETRKLCYKISWHPLAEAE
NAVEEDIQDRNGPAESHGDTYIHGDTNTNGNTKHQGNAHTNENPVKPKHDLCITYFGKSDGIADKLSIALSDESG
WQVSVRNFGEVNFSQKHLVLLQTGASSLRYLTEDVFEGLKKALLNARTVLWVYRTDSPDAQMTVGLTRTLRSETS
ARIATLGLVPDIKYPEKPIQAAISALWPTDGTQPTKDLEFKAKGSELFVQRIVEDDSANSFIHNETHDMTISTQP
FSQPGRRFKIQIGSQGSLDSLYFVDDNPLPLGDGQIELQVKANGLNFKDIVVSMGHLAQPYIGIECSGVVSSVGS
NVKNFKVGQRVMAMPEGCFSTYARCAATSATEIPADMSFEVAATVPVVFCTAYYSLFDLGHLQAGERVLIHAGAG
GVGQAAIMLAQMIGADIFTTIGSLDKKQFLMAQYGIPEDRIFYSRDTSFARSIRRATGDVGVDVIVNSLAGELLR
ETWECLAPFGRFVEIGKADITKNTRLDMQPFEHNVIFSSVDLTKVGKSKPQLMKRILGDICRLIGDGSVHPVLPL
SIYRISDIEKAFRTLQIGKSMGKIVVAPHEGDQVKAVAPKTSATLLRPDASYILIGGTGGLGRSMAKWMSSKGAK
NIVLVSRQAAINETVRTLIDTLAPLGVRIIVKACDVSSRESVKALINEEMKDLPPIRGVIHGAMVLRDMLFENMS
LEDFSAVACNKVEGAWNLHHALINSPLDFFIALSSIAGIIGNRGQAAYSAANAFLDGFIEYRRSLGLSGTSIDLA
AVSDVGYLADTDAQRRQEVMKNISCQTIDESEVLALIAAALTGDLDRSCSGQCVTGLGLDSLENNFWVQDARFSV
LYEAAKGTLGNSAQCNGPSVPLHVTLSTAPSKKEALRACYEALAAKLAQVLVLSLEDMDPSITVVSLGLDSLVAI
EIRNWIAREANANVQVLELLSSGSLMALAEIILNKSQAYTRTE*
Coding >Pro_DTO377G3_2|g319.t1
ATGACAAACATGAAGGGTGCTGATTCGGAAGGTGCGTCCTATGGCGACCAGGGTACCCTCCAACCTATCGCCATC
ATCGGGTATTCCTGCCGGCTGCCGGGGCAAGTTACATCTCCTAGTGAGCTATGGGAGCTATGTACCCGAGCTCGA
AGTGGCTGGTCACCCATCCCCAAAGACCGTTTTTCTGTCGAAGCATTCCATCATCCCAATTCATCCAAGATTGGT
TCCTTCAACCCAAAGGGAGGCTACTTCCTTGACGAGGACATTGCACAGTTCGATGCTCCTTTCTTCAACCTCACC
GTGCAGGAAGCTACGGCCATGGACCCTCAGCAGCGCTTGTTACTGGAGTGCGCGTATGAAGCTCTGGAGAGCGCT
GGCATCCCCAAAGAGAATTTTGCTCGCCGGAACGTGAGCGTCTTTGCGGGTGGTAATTTCGCTGATTATGAGCTC
AATAATGACCGTGATACCGAGACTATCCCTATGCACCAAGCTACAGGCTGTGCGGCCTCGCTGCAATCCAACCGT
ATTTCATACTTCTTCGATCTACGAGGACCCAGTGTCACAGTGGATACAGCTTGTTCTTCCTCACTTGTTGCTCTC
CACTATGCAGTACAGAGCTTGCGAAGCGGGGAATCCAAGGAAGCACTCGTTGCTGGTTGTCACCTTAACATCGTA
CCAGATATTTGGGTTTCGATGTCCATGTCACAGTTGTTTAATGATGAGGGTAAAACCTTCTCCTTCGACGAGAGA
GCCACATCCGGTTTTGCGCGAGGCGAGGGCTCTGGTGTCGTGATTTTGAAACCCCTCGACGCCGCCTTGCGTGAC
AAAGATCCCGTACGAGCTGTCGTTGTACATTCAGGAGTCAACCAGGATGGACGAACACAGGGAATCACATTGCCG
AATGGCCAGGCCCAGGAAGAGCTAATCCGGCAGGTCTACAAAGAGGCCAACATCAACCCGGACGAATGCGGTTTT
GTGGAGATGCATGGAACTGGAACAAAGGCCGGTGATCCTATCGAAGCTGCAGCAGTCCATGCAGCACTTGGAAAG
AATCGGACTCCAAGAAACCCACTTTACATTGGATCAGTCAAATCCAACATTGGGCATTTGGAGGGAGCCAGTGGT
ATAATTGCCATCATCAAAGCAGCCATGATGCTTGATAGAGAGCTAATGCTTCCAAACGCCGAGTTCAAGAAAGCG
AATCCTAATATTCCTATGAGCGACTGGAATATGAAAGTTTTAACGATGACGCGGCCATGGCCTCCTCGCAAGAAA
TATCTCAGCGTGTCCAATTACGGGTTTGGAGGAACCAATGCACATGCCGTACTTGAAAAAGCACCACTGTCATCA
AAAGCCCCAGACCGAGCTGTTGAGGATGTTGAAGTGGACCCCAAACGCAAGCTGTTCTTGATCTCTGCCAACGAC
AAGGAGTCACTACGCACTAGAATCAAAGACTTCGGTATCTACTTCGAACAGCATCCCGAGGTTTTTGAAAAGACT
CTGTTCGGCAACTTTGCTTATACCCTAGGCAACAAGATGTCTCAACTCTCATACCGTGTTGGCGTGTCAGCTACC
TCGCTAGATGAACTTGGTATCCGTCTCGCCCAATTGAATATCAACCCCTCTAGGGTTCTGGGAGCCCCAATAATT
TCGTTTGTCTTCACTGGTCAAGGGGCTCAATGGGCGCAGATGGGTGTTCCTCTTATGCATGAATATCCTGTCTAC
GAGTTGGCCATCAAACGAGCAGATCAATGCCTACGAGATCTCGGCGCCGAGTTCTCCCTTGTCGAAGAGTTGGAA
AAGGACGCAACCGCTTCCGACATTGACTCCCCTCATCTAAGTCAACCAGCGTGCACAGCGCTTCAAATTGCACTA
GTCAACCTCCTAGAATCATGGGGAATCCGGCCTGGTTCAGTCGTTGGCCACAGTTCTGGAGAAATCAGTGCAGCC
TACGCTGCGGGGATTTATGACTTAGAGGGAGCTATGGCTCTGGCTTACTGGCGTGGGCAAATGACCTCGTTGCTT
AAGTCCTCGTTCCCGTCCCTTAAGGGGACTATGATTGCTATTGGCACGAGCCGCGAAACTATTCAGCCTATACTA
AAGAACCTCTCTGGATATGCTACCGTTGCTTGCGTGAACAGTCCTACCAGCGTGACCGTGTCAGGAGACATATCC
ACGATTAGTGAACTCGAAAAGGTTGTCGATAATAAACAACTTTTCAACCGAAAATTGAAGATTGACGTTGCCTAT
CATTCCGACCACATGAAGAAGGTTTCCAAGGCCTACTTAGCTGCGATTGAGAACATTAGGCACTTCTCGTCGGCG
ATAACCCCATTCTTCTCTTCTGTCTTTGGGCGCTTCGCGGAACCCTTTGAACTTGGTCCAGAATACTGGATTGCG
AACCTGACATCACCGGTTTTATTCTCTGATGCTCTTGGCAAGATAGTGGCGGACGATGAAACACGACCCAGCCTT
CTTATTGAAATCGGTCCACACTCCACAATGAAAGGCCCCATCATGGATACTCTAAAGAGCTTGGGTCCCACTGTC
TCCAAGATTGCATATACACCAACTATTCTTCGTAAAGTGAATGCAGCTGAGTCCATCTTAGATACCGCTGCTGCT
GCCTACGTGCGAGGCGCTACGCTCAATATGACAGCAGTGAACTTTCCCAAGACCGGAGCGGCAAACCGGTGGTTC
TTGAGTAACTTGCCTCGCTACCCTTGGCAACATGGAACTCGGTACTGGCACGTTGCCCGTATTCCACAGAAGCAT
ATGGTCAGAGATGGTGCTAGGAACGATGTCTTGGGAGTATTGGCAAATTACTCAAATGATCTGGAGCCAACGTGG
CGGAACATCATCCGGTTAGATGAGGTTCCCTACCTCCGGGACCACAAGATGCAAGGGATGGTCGTTTACCCCTTA
GCAGGCTATTTGGTGATGGCCATTGAGGCTGCTCGACGACGCGCGAAGCAAGCTGATATTCAAATCTCCCAGTTT
GAACTCAGGGAGGTCATTGTGGGCTCAGCGTTTGTGCTTAGTGATGAGACAGATGCAGAGACCACCATTACTCTT
CGCCCCTACGCTGAGGGTACTCGTGGATCATCCGATCTTTGGGATGAGTTCCGTGTCTGCTCATGGACTTCAAAG
CGAGGATGGACAGAGCACTGTACTGGACAGGTACGGGTTCGCTCCGATCCGAAACAGCAGGCAGTTGTGATCTCG
AGTCCGTTCGAGACTCAAGCCACTTACATGAAAGCTCAAATTTCCCGAATTCAGAAACCGGCTACTAATTACCTC
GATATGTCCCACATGTACCAGGTTCTTGGTGATCTAGGAGCCGGGTATGGTCCTATCTTCCAGAATATTGATAAC
TGCTACTCCAGCCCTCACCACTCGTTTGGCGATCTATACGTTAGAAATACCCGCAGTGTCATGCCGAAGGGATTT
GAGACTCCCTTAACTGTCCACCCGTCATTCCTCGATGGACTGCTACATTTTGCTTGGCCCCTTCTTGGCCAGGGC
TTGGGCCGAATGGATCTGGACACACTTTACATGCCTACAGTAATCAAGCGTATGACAGTCGGTCTCAATGTACCA
ACCACCGCTGGTGAATACCTCAAAGGTTACTGTAGTGGCAGTCCCAGCTTGCCTTCCCCTGAACCGACCAAATTT
GACCTTTTTGCCACCCAGGAGGGCTCTACTGAACCTATTATTACAATAGATGGCCTGGTAATGACTCCCCTCAGA
GATTCAGACACTAACCGTGAAGAGACTCGCAAATTGTGCTATAAGATTAGTTGGCATCCTTTGGCCGAGGCTGAA
AACGCCGTTGAAGAAGATATTCAAGATCGCAACGGCCCCGCCGAATCTCACGGCGATACTTATATCCACGGAGAC
ACAAATACGAATGGGAATACAAAGCACCAAGGCAATGCGCACACAAATGAGAATCCCGTCAAGCCTAAGCACGAT
CTATGCATTACGTACTTTGGTAAATCCGATGGTATTGCTGATAAATTGAGTATTGCCCTGTCCGACGAATCCGGG
TGGCAGGTTTCCGTCCGGAACTTTGGTGAAGTGAACTTCTCTCAAAAGCACCTTGTTCTACTTCAGACTGGAGCT
AGCTCTCTGCGATACCTCACCGAGGATGTATTCGAGGGGCTCAAGAAGGCACTACTCAATGCTAGAACTGTGCTC
TGGGTCTATCGGACTGATTCTCCCGATGCTCAAATGACAGTCGGCTTGACTCGTACCTTGCGCTCCGAGACCTCG
GCTAGAATAGCCACTCTTGGGTTGGTTCCTGACATCAAATATCCCGAGAAGCCTATCCAGGCAGCTATCAGTGCT
CTATGGCCCACCGATGGAACTCAGCCCACGAAAGATCTCGAGTTCAAGGCCAAGGGCTCGGAGCTATTTGTCCAA
CGCATAGTGGAAGATGATTCTGCCAATAGTTTCATCCACAATGAGACCCACGACATGACAATCTCAACCCAACCG
TTCAGTCAGCCTGGGCGCCGCTTCAAGATCCAGATCGGCAGTCAAGGCTCCCTTGATTCCCTCTACTTTGTAGAC
GACAATCCCCTACCATTAGGCGATGGCCAAATTGAGCTTCAAGTTAAAGCAAACGGTCTTAACTTCAAAGACATT
GTGGTCTCTATGGGCCATCTTGCACAGCCTTATATTGGAATTGAATGCAGTGGTGTTGTCTCCAGTGTAGGTTCA
AATGTGAAGAATTTCAAGGTCGGTCAAAGAGTAATGGCCATGCCAGAGGGCTGTTTCTCGACTTATGCACGATGC
GCTGCGACTAGCGCGACAGAAATCCCAGCCGACATGTCATTCGAGGTTGCAGCCACCGTGCCAGTTGTATTCTGC
ACTGCATACTACTCTCTGTTTGACCTAGGTCATCTCCAAGCCGGCGAGCGGGTTTTAATCCACGCCGGTGCTGGA
GGTGTCGGTCAAGCTGCCATAATGCTAGCACAGATGATCGGTGCAGACATCTTTACAACAATCGGAAGCCTCGAC
AAGAAACAGTTCTTAATGGCCCAGTACGGTATTCCCGAAGACCGCATCTTTTATAGTCGTGATACATCTTTCGCT
CGCAGCATCCGCAGAGCCACCGGCGATGTTGGTGTGGATGTCATCGTCAACTCCCTGGCAGGCGAACTTTTGCGC
GAGACTTGGGAGTGTCTTGCACCTTTCGGAAGGTTTGTCGAGATCGGCAAGGCTGATATCACGAAGAATACTCGC
CTTGACATGCAGCCCTTTGAGCACAACGTCATATTCTCGTCGGTTGATCTCACCAAGGTTGGCAAGTCCAAGCCT
CAGCTGATGAAGCGCATCCTGGGTGATATATGTCGGTTGATTGGTGACGGGTCGGTGCATCCCGTCCTACCACTT
TCGATTTATCGAATTTCCGATATCGAGAAGGCATTCCGTACTCTACAGATCGGCAAGAGTATGGGTAAGATTGTG
GTGGCTCCTCATGAAGGTGACCAAGTCAAGGCTGTGGCTCCCAAGACCAGTGCCACTCTCTTACGACCCGATGCA
TCCTACATCTTGATTGGTGGTACTGGTGGTCTAGGCCGAAGCATGGCCAAGTGGATGTCCTCGAAAGGTGCAAAG
AACATTGTTCTTGTGTCTCGTCAAGCCGCGATTAATGAGACGGTTCGAACTTTGATAGATACTTTGGCTCCTCTA
GGAGTGCGAATTATCGTCAAGGCTTGCGATGTCAGCAGCCGTGAGTCTGTCAAGGCTCTGATTAACGAAGAGATG
AAAGACCTTCCCCCAATACGTGGTGTTATTCACGGTGCGATGGTGCTTCGTGATATGCTCTTCGAAAATATGTCT
CTTGAAGACTTCTCTGCCGTAGCGTGCAACAAGGTAGAAGGAGCTTGGAATCTGCATCACGCGCTGATCAATTCC
CCACTGGATTTCTTCATTGCCCTCTCATCGATAGCCGGCATCATCGGCAATCGCGGACAGGCAGCATATTCCGCA
GCAAATGCATTCCTGGATGGATTCATAGAATACCGCAGATCCCTTGGTCTTTCAGGAACATCAATCGACCTCGCT
GCAGTCAGCGACGTCGGCTACCTAGCCGATACCGACGCCCAGCGGCGACAGGAGGTAATGAAGAATATCAGCTGT
CAGACCATTGACGAGTCGGAAGTCTTGGCGTTGATAGCCGCCGCGTTAACCGGTGATCTTGATCGATCCTGCTCT
GGGCAGTGTGTCACGGGACTGGGACTGGATTCACTCGAGAACAACTTCTGGGTCCAGGATGCGAGGTTCAGCGTG
CTATATGAGGCCGCCAAGGGGACGCTGGGCAACAGCGCACAGTGCAACGGCCCGTCTGTGCCGCTGCATGTCACC
TTGTCGACTGCCCCATCTAAAAAAGAAGCCTTGAGAGCGTGCTACGAGGCGCTGGCTGCGAAGTTAGCGCAGGTG
CTTGTTCTCTCCTTGGAGGATATGGATCCCTCGATTACAGTGGTTTCATTGGGTCTTGACTCGCTGGTGGCTATT
GAGATTCGTAATTGGATTGCCCGTGAGGCTAATGCCAATGTGCAGGTTCTAGAGTTGTTGTCTAGTGGCAGTTTG
ATGGCCTTGGCCGAGATTATCCTCAACAAATCTCAGGCCTATACTCGCACTGAGTAA
Transcript >Pro_DTO377G3_2|g319.t1
ATGACAAACATGAAGGGTGCTGATTCGGAAGGTGCGTCCTATGGCGACCAGGGTACCCTCCAACCTATCGCCATC
ATCGGGTATTCCTGCCGGCTGCCGGGGCAAGTTACATCTCCTAGTGAGCTATGGGAGCTATGTACCCGAGCTCGA
AGTGGCTGGTCACCCATCCCCAAAGACCGTTTTTCTGTCGAAGCATTCCATCATCCCAATTCATCCAAGATTGGT
TCCTTCAACCCAAAGGGAGGCTACTTCCTTGACGAGGACATTGCACAGTTCGATGCTCCTTTCTTCAACCTCACC
GTGCAGGAAGCTACGGCCATGGACCCTCAGCAGCGCTTGTTACTGGAGTGCGCGTATGAAGCTCTGGAGAGCGCT
GGCATCCCCAAAGAGAATTTTGCTCGCCGGAACGTGAGCGTCTTTGCGGGTGGTAATTTCGCTGATTATGAGCTC
AATAATGACCGTGATACCGAGACTATCCCTATGCACCAAGCTACAGGCTGTGCGGCCTCGCTGCAATCCAACCGT
ATTTCATACTTCTTCGATCTACGAGGACCCAGTGTCACAGTGGATACAGCTTGTTCTTCCTCACTTGTTGCTCTC
CACTATGCAGTACAGAGCTTGCGAAGCGGGGAATCCAAGGAAGCACTCGTTGCTGGTTGTCACCTTAACATCGTA
CCAGATATTTGGGTTTCGATGTCCATGTCACAGTTGTTTAATGATGAGGGTAAAACCTTCTCCTTCGACGAGAGA
GCCACATCCGGTTTTGCGCGAGGCGAGGGCTCTGGTGTCGTGATTTTGAAACCCCTCGACGCCGCCTTGCGTGAC
AAAGATCCCGTACGAGCTGTCGTTGTACATTCAGGAGTCAACCAGGATGGACGAACACAGGGAATCACATTGCCG
AATGGCCAGGCCCAGGAAGAGCTAATCCGGCAGGTCTACAAAGAGGCCAACATCAACCCGGACGAATGCGGTTTT
GTGGAGATGCATGGAACTGGAACAAAGGCCGGTGATCCTATCGAAGCTGCAGCAGTCCATGCAGCACTTGGAAAG
AATCGGACTCCAAGAAACCCACTTTACATTGGATCAGTCAAATCCAACATTGGGCATTTGGAGGGAGCCAGTGGT
ATAATTGCCATCATCAAAGCAGCCATGATGCTTGATAGAGAGCTAATGCTTCCAAACGCCGAGTTCAAGAAAGCG
AATCCTAATATTCCTATGAGCGACTGGAATATGAAAGTTTTAACGATGACGCGGCCATGGCCTCCTCGCAAGAAA
TATCTCAGCGTGTCCAATTACGGGTTTGGAGGAACCAATGCACATGCCGTACTTGAAAAAGCACCACTGTCATCA
AAAGCCCCAGACCGAGCTGTTGAGGATGTTGAAGTGGACCCCAAACGCAAGCTGTTCTTGATCTCTGCCAACGAC
AAGGAGTCACTACGCACTAGAATCAAAGACTTCGGTATCTACTTCGAACAGCATCCCGAGGTTTTTGAAAAGACT
CTGTTCGGCAACTTTGCTTATACCCTAGGCAACAAGATGTCTCAACTCTCATACCGTGTTGGCGTGTCAGCTACC
TCGCTAGATGAACTTGGTATCCGTCTCGCCCAATTGAATATCAACCCCTCTAGGGTTCTGGGAGCCCCAATAATT
TCGTTTGTCTTCACTGGTCAAGGGGCTCAATGGGCGCAGATGGGTGTTCCTCTTATGCATGAATATCCTGTCTAC
GAGTTGGCCATCAAACGAGCAGATCAATGCCTACGAGATCTCGGCGCCGAGTTCTCCCTTGTCGAAGAGTTGGAA
AAGGACGCAACCGCTTCCGACATTGACTCCCCTCATCTAAGTCAACCAGCGTGCACAGCGCTTCAAATTGCACTA
GTCAACCTCCTAGAATCATGGGGAATCCGGCCTGGTTCAGTCGTTGGCCACAGTTCTGGAGAAATCAGTGCAGCC
TACGCTGCGGGGATTTATGACTTAGAGGGAGCTATGGCTCTGGCTTACTGGCGTGGGCAAATGACCTCGTTGCTT
AAGTCCTCGTTCCCGTCCCTTAAGGGGACTATGATTGCTATTGGCACGAGCCGCGAAACTATTCAGCCTATACTA
AAGAACCTCTCTGGATATGCTACCGTTGCTTGCGTGAACAGTCCTACCAGCGTGACCGTGTCAGGAGACATATCC
ACGATTAGTGAACTCGAAAAGGTTGTCGATAATAAACAACTTTTCAACCGAAAATTGAAGATTGACGTTGCCTAT
CATTCCGACCACATGAAGAAGGTTTCCAAGGCCTACTTAGCTGCGATTGAGAACATTAGGCACTTCTCGTCGGCG
ATAACCCCATTCTTCTCTTCTGTCTTTGGGCGCTTCGCGGAACCCTTTGAACTTGGTCCAGAATACTGGATTGCG
AACCTGACATCACCGGTTTTATTCTCTGATGCTCTTGGCAAGATAGTGGCGGACGATGAAACACGACCCAGCCTT
CTTATTGAAATCGGTCCACACTCCACAATGAAAGGCCCCATCATGGATACTCTAAAGAGCTTGGGTCCCACTGTC
TCCAAGATTGCATATACACCAACTATTCTTCGTAAAGTGAATGCAGCTGAGTCCATCTTAGATACCGCTGCTGCT
GCCTACGTGCGAGGCGCTACGCTCAATATGACAGCAGTGAACTTTCCCAAGACCGGAGCGGCAAACCGGTGGTTC
TTGAGTAACTTGCCTCGCTACCCTTGGCAACATGGAACTCGGTACTGGCACGTTGCCCGTATTCCACAGAAGCAT
ATGGTCAGAGATGGTGCTAGGAACGATGTCTTGGGAGTATTGGCAAATTACTCAAATGATCTGGAGCCAACGTGG
CGGAACATCATCCGGTTAGATGAGGTTCCCTACCTCCGGGACCACAAGATGCAAGGGATGGTCGTTTACCCCTTA
GCAGGCTATTTGGTGATGGCCATTGAGGCTGCTCGACGACGCGCGAAGCAAGCTGATATTCAAATCTCCCAGTTT
GAACTCAGGGAGGTCATTGTGGGCTCAGCGTTTGTGCTTAGTGATGAGACAGATGCAGAGACCACCATTACTCTT
CGCCCCTACGCTGAGGGTACTCGTGGATCATCCGATCTTTGGGATGAGTTCCGTGTCTGCTCATGGACTTCAAAG
CGAGGATGGACAGAGCACTGTACTGGACAGGTACGGGTTCGCTCCGATCCGAAACAGCAGGCAGTTGTGATCTCG
AGTCCGTTCGAGACTCAAGCCACTTACATGAAAGCTCAAATTTCCCGAATTCAGAAACCGGCTACTAATTACCTC
GATATGTCCCACATGTACCAGGTTCTTGGTGATCTAGGAGCCGGGTATGGTCCTATCTTCCAGAATATTGATAAC
TGCTACTCCAGCCCTCACCACTCGTTTGGCGATCTATACGTTAGAAATACCCGCAGTGTCATGCCGAAGGGATTT
GAGACTCCCTTAACTGTCCACCCGTCATTCCTCGATGGACTGCTACATTTTGCTTGGCCCCTTCTTGGCCAGGGC
TTGGGCCGAATGGATCTGGACACACTTTACATGCCTACAGTAATCAAGCGTATGACAGTCGGTCTCAATGTACCA
ACCACCGCTGGTGAATACCTCAAAGGTTACTGTAGTGGCAGTCCCAGCTTGCCTTCCCCTGAACCGACCAAATTT
GACCTTTTTGCCACCCAGGAGGGCTCTACTGAACCTATTATTACAATAGATGGCCTGGTAATGACTCCCCTCAGA
GATTCAGACACTAACCGTGAAGAGACTCGCAAATTGTGCTATAAGATTAGTTGGCATCCTTTGGCCGAGGCTGAA
AACGCCGTTGAAGAAGATATTCAAGATCGCAACGGCCCCGCCGAATCTCACGGCGATACTTATATCCACGGAGAC
ACAAATACGAATGGGAATACAAAGCACCAAGGCAATGCGCACACAAATGAGAATCCCGTCAAGCCTAAGCACGAT
CTATGCATTACGTACTTTGGTAAATCCGATGGTATTGCTGATAAATTGAGTATTGCCCTGTCCGACGAATCCGGG
TGGCAGGTTTCCGTCCGGAACTTTGGTGAAGTGAACTTCTCTCAAAAGCACCTTGTTCTACTTCAGACTGGAGCT
AGCTCTCTGCGATACCTCACCGAGGATGTATTCGAGGGGCTCAAGAAGGCACTACTCAATGCTAGAACTGTGCTC
TGGGTCTATCGGACTGATTCTCCCGATGCTCAAATGACAGTCGGCTTGACTCGTACCTTGCGCTCCGAGACCTCG
GCTAGAATAGCCACTCTTGGGTTGGTTCCTGACATCAAATATCCCGAGAAGCCTATCCAGGCAGCTATCAGTGCT
CTATGGCCCACCGATGGAACTCAGCCCACGAAAGATCTCGAGTTCAAGGCCAAGGGCTCGGAGCTATTTGTCCAA
CGCATAGTGGAAGATGATTCTGCCAATAGTTTCATCCACAATGAGACCCACGACATGACAATCTCAACCCAACCG
TTCAGTCAGCCTGGGCGCCGCTTCAAGATCCAGATCGGCAGTCAAGGCTCCCTTGATTCCCTCTACTTTGTAGAC
GACAATCCCCTACCATTAGGCGATGGCCAAATTGAGCTTCAAGTTAAAGCAAACGGTCTTAACTTCAAAGACATT
GTGGTCTCTATGGGCCATCTTGCACAGCCTTATATTGGAATTGAATGCAGTGGTGTTGTCTCCAGTGTAGGTTCA
AATGTGAAGAATTTCAAGGTCGGTCAAAGAGTAATGGCCATGCCAGAGGGCTGTTTCTCGACTTATGCACGATGC
GCTGCGACTAGCGCGACAGAAATCCCAGCCGACATGTCATTCGAGGTTGCAGCCACCGTGCCAGTTGTATTCTGC
ACTGCATACTACTCTCTGTTTGACCTAGGTCATCTCCAAGCCGGCGAGCGGGTTTTAATCCACGCCGGTGCTGGA
GGTGTCGGTCAAGCTGCCATAATGCTAGCACAGATGATCGGTGCAGACATCTTTACAACAATCGGAAGCCTCGAC
AAGAAACAGTTCTTAATGGCCCAGTACGGTATTCCCGAAGACCGCATCTTTTATAGTCGTGATACATCTTTCGCT
CGCAGCATCCGCAGAGCCACCGGCGATGTTGGTGTGGATGTCATCGTCAACTCCCTGGCAGGCGAACTTTTGCGC
GAGACTTGGGAGTGTCTTGCACCTTTCGGAAGGTTTGTCGAGATCGGCAAGGCTGATATCACGAAGAATACTCGC
CTTGACATGCAGCCCTTTGAGCACAACGTCATATTCTCGTCGGTTGATCTCACCAAGGTTGGCAAGTCCAAGCCT
CAGCTGATGAAGCGCATCCTGGGTGATATATGTCGGTTGATTGGTGACGGGTCGGTGCATCCCGTCCTACCACTT
TCGATTTATCGAATTTCCGATATCGAGAAGGCATTCCGTACTCTACAGATCGGCAAGAGTATGGGTAAGATTGTG
GTGGCTCCTCATGAAGGTGACCAAGTCAAGGCTGTGGCTCCCAAGACCAGTGCCACTCTCTTACGACCCGATGCA
TCCTACATCTTGATTGGTGGTACTGGTGGTCTAGGCCGAAGCATGGCCAAGTGGATGTCCTCGAAAGGTGCAAAG
AACATTGTTCTTGTGTCTCGTCAAGCCGCGATTAATGAGACGGTTCGAACTTTGATAGATACTTTGGCTCCTCTA
GGAGTGCGAATTATCGTCAAGGCTTGCGATGTCAGCAGCCGTGAGTCTGTCAAGGCTCTGATTAACGAAGAGATG
AAAGACCTTCCCCCAATACGTGGTGTTATTCACGGTGCGATGGTGCTTCGTGATATGCTCTTCGAAAATATGTCT
CTTGAAGACTTCTCTGCCGTAGCGTGCAACAAGGTAGAAGGAGCTTGGAATCTGCATCACGCGCTGATCAATTCC
CCACTGGATTTCTTCATTGCCCTCTCATCGATAGCCGGCATCATCGGCAATCGCGGACAGGCAGCATATTCCGCA
GCAAATGCATTCCTGGATGGATTCATAGAATACCGCAGATCCCTTGGTCTTTCAGGAACATCAATCGACCTCGCT
GCAGTCAGCGACGTCGGCTACCTAGCCGATACCGACGCCCAGCGGCGACAGGAGGTAATGAAGAATATCAGCTGT
CAGACCATTGACGAGTCGGAAGTCTTGGCGTTGATAGCCGCCGCGTTAACCGGTGATCTTGATCGATCCTGCTCT
GGGCAGTGTGTCACGGGACTGGGACTGGATTCACTCGAGAACAACTTCTGGGTCCAGGATGCGAGGTTCAGCGTG
CTATATGAGGCCGCCAAGGGGACGCTGGGCAACAGCGCACAGTGCAACGGCCCGTCTGTGCCGCTGCATGTCACC
TTGTCGACTGCCCCATCTAAAAAAGAAGCCTTGAGAGCGTGCTACGAGGCGCTGGCTGCGAAGTTAGCGCAGGTG
CTTGTTCTCTCCTTGGAGGATATGGATCCCTCGATTACAGTGGTTTCATTGGGTCTTGACTCGCTGGTGGCTATT
GAGATTCGTAATTGGATTGCCCGTGAGGCTAATGCCAATGTGCAGGTTCTAGAGTTGTTGTCTAGTGGCAGTTTG
ATGGCCTTGGCCGAGATTATCCTCAACAAATCTCAGGCCTATACTCGCACTGAGTAA
Gene >Pro_DTO377G3_2|g319.t1
ATGACAAACATGAAGGGTGCTGATTCGGAAGGTGCGTCCTATGGCGACCAGGGTACCCTCCAACCTATCGCCATC
ATCGGGTATTCCTGCCGGCTGCCGGGGCAAGTTACATCTCCTAGTGAGCTATGGGAGCTATGTACCCGAGCTCGA
AGTGGCTGGTCACCCATCCCCAAAGACCGTTTTTCTGTCGAAGCATTCCATCATCCCAATTCATCCAAGATTGGT
TCCTTCAACCCAAAGGGAGGCTACTTCCTTGACGAGGACATTGCACAGTTCGATGCTCCTTTCTTCAACCTCACC
GTGCAGGAAGCTACGGCCATGGACCCTCAGCAGCGCTTGTTACTGGAGTGCGCGTATGAAGCTCTGGAGAGCGCT
GGCATCCCCAAAGAGAATTTTGCTCGCCGGAACGTGAGCGTCTTTGCGGGTGGTAATTTCGCTGATTATGAGCTC
AATAATGACCGTGATACCGAGACTATCCCTATGCACCAAGCTACAGGCTGTGCGGCCTCGCTGCAATCCAACCGT
ATTTCATACTTCTTCGATCTACGAGGACCCAGTGTCACAGTGGATACAGCTTGTTCTTCCTCACTTGTTGCTCTC
CACTATGCAGTACAGAGCTTGCGAAGCGGGGAATCCAAGGAAGCACTCGTTGCTGGTTGTCACCTTAACATCGTA
CCAGATATTTGGGTTTCGATGTCCATGTCACAGTATGTATTTGCGTGTCCTCCAAGCCAAGTTGGAGATCATATG
ACCTGACTGTCTGGAATCATATAGGTTGTTTAATGATGAGGGTAAAACCTTCTCCTTCGACGAGAGAGCCACATC
CGGTTTTGCGCGAGGCGAGGGCTCTGGTGTCGTGATTTTGAAACCCCTCGACGCCGCCTTGCGTGACAAAGATCC
CGTACGAGCTGTCGTTGTACATTCAGGAGTCAACCAGGATGGACGAACACAGGGAATCACATTGCCGAATGGCCA
GGCCCAGGAAGAGCTAATCCGGCAGGTCTACAAAGAGGCCAACATCAACCCGGACGAATGCGGTTTTGTGGAGAT
GCATGGAACTGGAACAAAGGCCGGTGATCCTATCGAAGCTGCAGCAGTCCATGCAGCACTTGGAAAGAATCGGAC
TCCAAGAAACCCACTTTACATTGGATCAGTCAAATCCAACATTGGGCATTTGGAGGGAGCCAGTGGTATAATTGC
CATCATCAAAGCAGCCATGATGCTTGATAGAGAGCTAATGCTTCCAAACGCCGAGTTCAAGAAAGCGAATCCTAA
TATTCCTATGAGCGACTGGAATATGAAAGTTTTAACGATGACGCGGCCATGGCCTCCTCGCAAGAAATATCTCAG
CGTGTCCAATTACGGGTTTGGAGGAACCAATGCACATGCCGTACTTGAAAAAGCACCACTGTCATCAAAAGCCCC
AGACCGAGCTGTTGAGGATGTTGAAGTGGACCCCAAACGCAAGCTGTTCTTGATCTCTGCCAACGACAAGGAGTC
ACTACGCACTAGAATCAAAGACTTCGGTATCTACTTCGAACAGCATCCCGAGGTTTTTGAAAAGACTCTGTTCGG
CAACTTTGCTTATACCCTAGGCAACAAGATGTCTCAACTCTCATACCGTGTTGGCGTGTCAGCTACCTCGCTAGA
TGAACTTGGTATCCGTCTCGCCCAATTGAATATCAACCCCTCTAGGGTTCTGGGAGCCCCAATAATTTCGTTTGT
CTTCACTGGTCAAGGGGCTCAATGGGCGCAGATGGGTGTTCCTCTTATGCATGAATATCCTGTCTACGAGTTGGC
CATCAAACGAGCAGATCAATGCCTACGAGATCTCGGCGCCGAGTTCTCCCTTGTCGAAGAGTTGGAAAAGGACGC
AACCGCTTCCGACATTGACTCCCCTCATCTAAGTCAACCAGCGTGCACAGCGCTTCAAATTGCACTAGTCAACCT
CCTAGAATCATGGGGAATCCGGCCTGGTTCAGTCGTTGGCCACAGTTCTGGAGAAATCAGTGCAGCCTACGCTGC
GGGGATTTATGACTTAGAGGGAGCTATGGCTCTGGCTTACTGGCGTGGGCAAATGACCTCGTTGCTTAAGTCCTC
GTTCCCGTCCCTTAAGGGGACTATGATTGCTATTGGCACGAGCCGCGAAACTATTCAGCCTATACTAAAGAACCT
CTCTGGATATGCTACCGTTGCTTGCGTGAACAGTCCTACCAGCGTGACCGTGTCAGGAGACATATCCACGATTAG
TGAACTCGAAAAGGTTGTCGATAATAAACAACTTTTCAACCGAAAATTGAAGATTGACGTTGCCTATCATTCCGA
CCACATGAAGAAGGTTTCCAAGGCCTACTTAGCTGCGATTGAGAACATTAGGCACTTCTCGTCGGCGATAACCCC
ATTCTTCTCTTCTGTCTTTGGGCGCTTCGCGGAACCCTTTGAACTTGGTCCAGAATACTGGATTGCGAACCTGAC
ATCACCGGTTTTATTCTCTGATGCTCTTGGCAAGATAGTGGCGGACGATGAAACACGACCCAGCCTTCTTATTGA
AATCGGTCCACACTCCACAATGAAAGGCCCCATCATGGATACTCTAAAGAGCTTGGGTCCCACTGTCTCCAAGAT
TGCATATACACCAACTATTCTTCGTAAAGTGAATGCAGCTGAGTCCATCTTAGATACCGCTGCTGCTGCCTACGT
GCGAGGCGCTACGCTCAATATGACAGCAGTGAACTTTCCCAAGACCGGAGCGGCAAACCGGTGGTTCTTGAGTAA
CTTGCCTCGCTACCCTTGGCAACATGGAACTCGGTACTGGCACGTTGCCCGTATTCCACAGAAGCATATGGTCAG
AGATGGTGCTAGGAACGATGTCTTGGGAGTATTGGCAAATTACTCAAATGATCTGGAGCCAACGTGGCGGAACAT
CATCCGGTTAGATGAGGTTCCCTACCTCCGGGACCACAAGATGCAAGGGATGGTCGTTTACCCCTTAGCAGGCTA
TGTAGGTTTAATGGATGATCCGCATATCTAAATAATGCTGACTGACTGTCCAATAGTTGGTGATGGCCATTGAGG
CTGCTCGACGACGCGCGAAGCAAGCTGATATTCAAATCTCCCAGTTTGAACTCAGGGAGGTCATTGTGGGCTCAG
CGTTTGTGCTTAGTGATGAGACAGATGCAGAGACCACCATTACTCTTCGCCCCTACGCTGAGGGTACTCGTGGAT
CATCCGATCTTTGGGATGAGTTCCGTGTCTGCTCATGGACTTCAAAGCGAGGATGGACAGAGCACTGTACTGGAC
AGGTACGGGTTCGCTCCGATCCGAAACAGCAGGCAGTTGTGATCTCGAGTCCGTTCGAGACTCAAGCCACTTACA
TGAAAGCTCAAATTTCCCGAATTCAGAAACCGGCTACTAATTACCTCGATATGTCCCACATGTACCAGGTTCTTG
GTGATCTAGGAGCCGGGTATGGTCCTATCTTCCAGAATATTGATAACTGCTACTCCAGCCCTCACCACTCGTTTG
GCGATCTATACGTTAGAAATACCCGCAGTGTCATGCCGAAGGGATTTGAGACTCCCTTAACTGTCCACCCGTCAT
TCCTCGATGGACTGCTACATTTTGCTTGGCCCCTTCTTGGCCAGGGCTTGGGCCGAATGGATCTGGACACACTTT
ACATGCCTACAGTAATCAAGCGTATGACAGTCGGTCTCAATGTACCAACCACCGCTGGTGAATACCTCAAAGGTT
ACTGTAGTGGCAGTCCCAGCTTGCCTTCCCCTGAACCGACCAAATTTGACCTTTTTGCCACCCAGGAGGGCTCTA
CTGAACCTATTATTACAATAGATGGCCTGGTAATGACTCCCCTCAGAGATTCAGACACTAACCGTGAAGAGACTC
GCAAATTGTGCTATAAGATTAGTTGGCATCCTTTGGCCGAGGCTGAAAACGCCGTTGAAGAAGATATTCAAGATC
GCAACGGCCCCGCCGAATCTCACGGCGATACTTATATCCACGGAGACACAAATACGAATGGGAATACAAAGCACC
AAGGCAATGCGCACACAAATGAGAATCCCGTCAAGCCTAAGCACGATCTATGCATTACGTACTTTGGTAAATCCG
ATGGTATTGCTGATAAATTGAGTATTGCCCTGTCCGACGAATCCGGGTGGCAGGTTTCCGTCCGGAACTTTGGTG
AAGTGAACTTCTCTCAAAAGCACCTTGTTCTACTTCAGACTGGAGCTAGCTCTCTGCGATACCTCACCGAGGATG
TATTCGAGGGGCTCAAGAAGGCACTACTCAATGCTAGAACTGTGCTCTGGGTCTATCGGACTGATTCTCCCGATG
CTCAAATGACAGTCGGCTTGACTCGTACCTTGCGCTCCGAGACCTCGGCTAGAATAGCCACTCTTGGGTTGGTTC
CTGACATCAAATATCCCGAGAAGCCTATCCAGGCAGCTATCAGTGCTCTATGGCCCACCGATGGAACTCAGCCCA
CGAAAGATCTCGAGTTCAAGGCCAAGGGCTCGGAGCTATTTGTCCAACGCATAGTGGAAGATGATTCTGCCAATA
GTTTCATCCACAATGAGACCCACGACATGACAATCTCAACCCAACCGTTCAGTCAGCCTGGGCGCCGCTTCAAGA
TCCAGATCGGCAGTCAAGGCTCCCTTGATTCCCTCTACTTTGTAGACGACAATCCCCTACCATTAGGCGATGGCC
AAATTGAGCTTCAAGTTAAAGCAAACGGTCTTAACTTCAAAGACATTGTGGTCTCTATGGGCCATCTTGCACAGC
CTTATATTGGAATTGAATGCAGTGGTGTTGTCTCCAGTGTAGGTTCAAATGTGAAGAATTTCAAGGTCGGTCAAA
GAGTAATGGCCATGCCAGAGGGCTGTTTCTCGACTTATGCACGATGCGCTGCGACTAGCGCGACAGAAATCCCAG
CCGACATGTCATTCGAGGTTGCAGCCACCGTGCCAGTTGTATTCTGCACTGCATACTACTCTCTGTTTGACCTAG
GTCATCTCCAAGCCGGCGAGCGGGTTTTAATCCACGCCGGTGCTGGAGGTGTCGGTCAAGCTGCCATAATGCTAG
CACAGATGATCGGTGCAGACATCTTTACAACAATCGGAAGCCTCGACAAGAAACAGTTCTTAATGGCCCAGTACG
GTATTCCCGAAGACCGCATCTTTTATAGTCGTGATACATCTTTCGCTCGCAGCATCCGCAGAGCCACCGGCGATG
TTGGTGTGGATGTCATCGTCAACTCCCTGGCAGGCGAACTTTTGCGCGAGACTTGGGAGTGTCTTGCACCTTTCG
GAAGGTTTGTCGAGATCGGCAAGGCTGATATCACGAAGAATACTCGCCTTGACATGCAGCCCTTTGAGCACAACG
TCATATTCTCGTCGGTTGATCTCACCAAGGTTGGCAAGTCCAAGCCTCAGCTGATGAAGCGCATCCTGGGTGATA
TATGTCGGTTGATTGGTGACGGGTCGGTGCATCCCGTCCTACCACTTTCGATTTATCGAATTTCCGATATCGAGA
AGGCATTCCGTACTCTACAGATCGGCAAGAGTATGGGTAAGATTGTGGTGGCTCCTCATGAAGGTGACCAAGTCA
AGGTAAACAAAGCACATCCGCGATTAAATTTCAGATCTAATCGTTCATTTTTCAGGCTGTGGCTCCCAAGACCAG
TGCCACTCTCTTACGACCCGATGCATCCTACATCTTGATTGGTGGTACTGGTGGTCTAGGCCGAAGCATGGCCAA
GTGGATGTCCTCGAAAGGTGCAAAGAACATTGTTCTTGTGTCTCGTCAAGCCGCGATTAATGAGACGGTTCGAAC
TTTGATAGATACTTTGGCTCCTCTAGGAGTGCGAATTATCGTCAAGGCTTGCGATGTCAGCAGCCGTGAGTCTGT
CAAGGCTCTGATTAACGAAGAGATGAAAGACCTTCCCCCAATACGTGGTGTTATTCACGGTGCGATGGTGCTTCG
TGTAAGATTTTACTATGATGACTTATTTACATTATCTGTTTTCATTACTGACCCTACTTAGGATATGCTCTTCGA
AAATATGTCTCTTGAAGACTTCTCTGCCGTAGCGTGCAACAAGGTAGAAGGAGCTTGGAATCTGCATCACGCGCT
GATCAATTCCCCACTGGATTTCTTCATTGCCCTCTCATCGATAGCCGGCATCATCGGCAATCGCGGACAGGCAGC
ATATTCCGCAGCAAATGCATTCCTGGATGGATTCATAGAATACCGCAGATCCCTTGGTCTTTCAGGAACATCAAT
CGACCTCGCTGCAGTCAGCGACGTCGGCTACCTAGCCGATACCGACGCCCAGCGGCGACAGGAGGTAATGAAGAA
TATCAGCTGTCAGACCATTGACGAGTCGGAAGTCTTGGCGTTGATAGCCGCCGCGTTAACCGGTGATCTTGATCG
ATCCTGCTCTGGGCAGTGTGTCACGGGACTGGGACTGGATTCACTCGAGAACAACTTCTGGGTCCAGGATGCGAG
GTTCAGCGTGCTATATGAGGCCGCCAAGGGGACGCTGGGCAACAGCGCACAGTGCAACGGCCCGTCTGTGCCGCT
GCATGTCACCTTGTCGACTGCCCCATCTAAAAAAGAAGCCTTGAGAGCGTGCTACGAGGCGCTGGCTGCGAAGTT
AGCGCAGGTGCTTGTTCTCTCCTTGGAGGATATGGATCCCTCGATTACAGTGGTTTCATTGGGTCTTGACTCGCT
GGTGGCTATTGAGATTCGTAATTGGATTGCCCGTGAGGCTAATGCCAATGTGCAGGTTCTAGAGTTGTTGTCTAG
TGGCAGTTTGATGGCCTTGGCCGAGATTATCCTCAACAAATCTCAGGCCTATACTCGCACTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail